KEGG   Pirellula staleyi: Psta_1832
Entry
Psta_1832         CDS       T01147                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
psl  Pirellula staleyi
Brite
KEGG Orthology (KO) [BR:psl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psl02044]
    Psta_1832
Secretion system [BR:psl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psta_1832
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ADB16506
UniProt: D2QZM3
Position
2322701..2324200
AA seq 499 aa
MSMDPSLQSAQQGAETTFASSDFSSLLQKEFKPKSDRAKEAVESAVKTLAQQALEGTAVV
SDDAIKTIQAIIASIDQKLSEQVNLILHNPDFQQLEGAWRGLHYLVNNTETDEMLKIRVF
NISKKELGKTLKKFKGTAWDQSPIFKKMYEEEYGQFGGEPYGCLVGDYHFDHSPPDVELL
GEISKVCAAAHAPFIAGASPTLMQMDSWQELSNPRDLTKIFGTAEYAPWRSLRESDDSRY
IGLAMPRFLSRLPYGAKTDPVSEFDFEEDVENADHSKYTWSNAAYAMATNINRSFKLYGW
CSRIRGIESGGAVEGLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHKKNS
DFAAFIGAQSLQKPQEYDDPDATANANLSARLPYLFATCRFAHYLKCIVRDKLGSFKEKE
DMQGWLNRWVSNYIEYNPKLASEEDKARRPLAAAEVTVEEVEGNPGYYSSKMFLRPHYQL
EGLTVSLRLVSKLPSGKGG
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgtcgatggatcccagtttgcagtcagcccagcaaggtgccgaaaccaccttcgcttcg
agcgatttttcgtcgctcctccaaaaagaattcaaacccaagagcgatcgtgctaaggaa
gccgttgagtcggctgtaaagaccttggctcagcaagctctcgaagggaccgctgttgtt
tccgacgacgcgatcaagacgatccaggccatcatcgcctcgatcgatcagaagctctcg
gaacaggtcaacctgattctgcacaaccctgattttcagcagctcgaaggtgcctggcgt
ggtttgcactacctcgtcaacaacaccgaaaccgacgaaatgctgaagatccgcgtcttc
aacatctcgaagaaagaactcggcaagacgctcaagaagttcaagggaacggcttgggat
cagagcccgatcttcaagaagatgtatgaagaagaatacggccaattcggtggcgagccc
tacggctgcctcgtgggtgattatcacttcgatcacagcccacccgatgtcgaattgctc
ggcgaaatctcgaaggtttgcgccgctgctcacgctccgttcatcgccggtgcttccccc
acgctcatgcaaatggattcgtggcaggaactctcgaaccctcgcgatctgaccaagatc
ttcggcaccgccgaatacgctccttggcgttcgctccgcgaatcggacgattcacgctac
atcggcctagcgatgccacgcttcctctcgcgattgccttacggcgcgaagaccgaccca
gtctcggaattcgacttcgaagaggatgtcgagaacgctgatcacagcaagtacacctgg
tcgaacgctgcttacgcgatggccacgaacatcaaccgttcgttcaagctctacggctgg
tgctcgcgtattcgcggtatcgaatcgggcggtgccgtggaaggcttgccttgccatacg
ttccccaccgacgacggtggcgtggacatgaagtgccccaccgaaatcgcgatcagcgac
cgccgcgaagcggaactcgccaaaaacggtttcatgccactcgtgcacaagaagaactcg
gacttcgccgcgttcattggtgctcagtcgctccagaagccacaggaatacgacgatccc
gatgccacggccaacgccaacctgtcggcccgtctcccttacttgtttgccacttgccgc
ttcgctcactatctcaagtgcatcgttcgcgacaaactgggttcattcaaagaaaaggaa
gacatgcagggttggctcaaccgctgggtgtcgaactacatcgaatacaacccgaagctc
gcttcggaagaagacaaagctcgccgcccactcgctgcagctgaagtgaccgtcgaagaa
gtggaaggtaacccaggttactactcttcgaagatgttcctccgcccccactaccagctg
gaaggtttgaccgtgtcgctgcgactcgtgtcgaaactcccatcgggcaagggtggttag

DBGET integrated database retrieval system