KEGG   Pirellula staleyi: Psta_2871Help
Entry
Psta_2871         CDS       T01147                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
psl  Pirellula staleyi
Pathway
psl00520  Amino sugar and nucleotide sugar metabolism
psl01100  Metabolic pathways
psl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Psta_2871
Enzymes [BR:psl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Psta_2871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ADB17536
UniProt: D2R8J5
Position
complement(3720370..3721539)
Genome map
AA seq 389 aa AA seqDB search
MNTFRLLARRYDTLRPVVVDIAAGHIQSIQADFAHQTSAGHLPIVAPGLIDLQVNGLAGH
ELNHPHVSPDDVEAVTQGMLQAGVTHYLPTCTTDSRELLVRSLGVIATAKESLPRSRQSI
AGIHLEGPYISAEDGPRGAHPREHVRPPSLEEFKQLQSAARGHIKLVTLSPEYPDSIELI
RYLVQQGVLVAIGHTAASSEQITAAVDAGATLSTHLGNGAHPSIKRHPNYIWDQLADDRL
TATLIADGHHLPTSVLKSMLRVKGLERSLLVSDITALAGMPPGIYRSGLGEVEVLEDGKL
VVAHQRQLLAGASRDLLYCINHLRSALGLSIENAIDLASLRPAQHLGMASHGLEIGAPAN
LVVLSLRDLQLHHECTILGGEIVSGNLIA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacctttcgcctcctcgcccgccgctacgacacgcttcgccctgtcgtcgtcgac
attgcggctggtcacattcagtcgatccaggccgattttgcccaccaaacatcggctggc
catttgccaatcgttgctccgggactcatcgacctgcaggtgaatggtcttgccggacac
gaactcaatcacccccatgtttcgccagacgatgtggaggcggtgactcaagggatgctg
caagctggcgttacgcattacttgccaacgtgcacgaccgactcgcgcgaactgctcgtg
cgatcgctgggagtcattgccacggccaaagaaagtttgccacgaagccggcaatcgatc
gccggcattcatctcgaaggaccgtacatctctgccgaagatggcccgcgcggagctcac
ccccgcgaacatgtccgtccaccttccctcgaagagtttaaacagctgcaatcagccgct
cgtggccatatcaaactcgtcactctatcgccggaatatcccgattcgattgagttaatt
cgctacctagtacagcagggtgtgcttgtggcaatcggacatacggctgctagttccgag
caaatcaccgctgcggtcgacgctggcgctacactgagcacacatctgggaaatggcgct
catcccagcatcaagcgtcatccgaattacatatgggatcagcttgccgacgatcgactc
acagcgacgctgattgccgatgggcatcacttacccacgagtgttctcaagtcgatgctg
cgcgtgaaaggactcgagcggtcgctactcgttagcgatatcacggcccttgccggaatg
ccccccggaatctaccgcagcggactgggggaagtggaagtgctcgaagacggaaagctc
gtcgtggcgcaccagcgtcaattgctcgcaggggcttcgcgcgatctactctactgcatc
aatcatttgcgctcagcgctcgggctatcgatcgaaaatgcgatcgatctggcaagtctt
cgaccagcgcaacacttggggatggccagccatggcctcgaaatcggggcaccagctaat
cttgtggtgctatctctgcgcgatctgcaattgcatcacgagtgtacgattctcggtgga
gaaatcgtgagcggcaacctgattgcttaa

DBGET integrated database retrieval system