KEGG   Pirellula staleyi: Psta_3574Help
Entry
Psta_3574         CDS       T01147                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
psl  Pirellula staleyi
Pathway
psl00030  Pentose phosphate pathway
psl01100  Metabolic pathways
psl01120  Microbial metabolism in diverse environments
psl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psta_3574
Enzymes [BR:psl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Psta_3574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: ADB18235
UniProt: D2QZ43
Position
4667718..4668512
Genome map
AA seq 264 aa AA seqDB search
MTDVNLKGRVAVVTGASLGIGRAAALELARCGASVVVNYRSHLHQAEEVIAEVEKLGSRG
IVFQADVADQGAVEAMVQAAVDNFGRLDIAVSNAAYSDRERFFEADMAGFHRTVNVTMWG
AFYLMRAATQQMIRQGEGGAICLVSSPHAFIPAPKAMAYNMSKAAIEHAARTAAIEVAEY
KIRINLIQPGWTDTPGERKFASEETLQSAGAKIPLGRLGNPEEMGRAIAFLCDPRNDYLT
GAALLVDGGISLPWWANRGSAAPA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtgaacctgaaaggccgcgtggctgtggtgaccggcgcaagtctcggaatc
ggacgtgctgcggctctggaattggcacgctgcggagccagtgtggtggtgaattaccga
agccatctgcaccaggccgaggaagtgattgcggaggtcgaaaaactagggtcgcgcggg
attgtgttccaggccgatgtggccgaccaaggggcggtggaggcaatggttcaagcggcg
gtcgacaatttcggtcgactcgatatcgccgtcagcaacgctgcctacagtgatcgcgag
cgttttttcgaggccgatatggccgggtttcaccgcaccgtcaacgtgacgatgtggggg
gcgttttacctgatgcgagccgccacgcagcaaatgatccgccaaggtgaaggaggcgcg
atctgcctcgtaagttcgccccacgcctttattccggccccaaaggcgatggcctacaac
atgtcgaaggctgcgatcgaacatgctgcccgcacagccgccattgaagtggcggaatac
aagattcggatcaatctgattcagccggggtggaccgataccccaggggagcggaaattt
gccagtgaagagacgctgcaatcggcgggggccaaaattccgctcggtcggctcggcaat
ccagaggaaatgggtcgcgcgattgccttcctgtgcgatcctcgcaacgactatctcacc
ggggcggcgctgctggtcgatgggggcatcagcttgccttggtgggcgaaccgtggatca
gctgcacctgcttaa

DBGET integrated database retrieval system