KEGG   Pirellula staleyi: Psta_3898Help
Entry
Psta_3898         CDS       T01147                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psl  Pirellula staleyi
Pathway
psl00010  Glycolysis / Gluconeogenesis
psl00020  Citrate cycle (TCA cycle)
psl00620  Pyruvate metabolism
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01120  Microbial metabolism in diverse environments
psl01130  Biosynthesis of antibiotics
psl01200  Carbon metabolism
Module
psl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psta_3898
   00020 Citrate cycle (TCA cycle)
    Psta_3898
   00620 Pyruvate metabolism
    Psta_3898
Enzymes [BR:psl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Psta_3898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N PASTA
Motif
Other DBs
NCBI-ProteinID: ADB18552
UniProt: D2R167
Position
5075185..5076594
Genome map
AA seq 469 aa AA seqDB search
MAIEVKLPNLGDGVDDGDVLEVLVKEGDTIAKDQGILEIETGKATMQVPSSAAGKVIKVH
VAAGQKVSVGTLVLTLEGAGAPAAAPAAAPAAPAAAPPPKPAPVAEAPKPAAAPAPAPPK
VAPAPVQPLRPAAPAPVPVAAEPALEAAVVTENLTEAEVAAGPAVRRFAREVGVDLARVT
GTGPGGRITRDDVLAVVRQAAQAATSPAKPAAASTSAPAAAAPAAPAAAPADRDNWGPIR
VEKMTKIRKTIAAKMHESWSSVPRVTNFDDADITELERIRQSSKDDYARKGIKLTSMPFV
IKAVAMALKQHPAINAAIDPSGESIIYKQYVNIGIAVDTERGLVVPSLRGMDALSIPEIA
RSLATLADNVRDNNFSMADLQGSTFTISNLGAVGGTYSTPIVNTPEVAILLLGRSRKKPV
VIDDEIQIRMMMPLSLSYDHRLVDGATAARFLNDVMGYLKTPSRLLLAP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccattgaagtaaaactgccgaacctgggcgacggtgtggacgacggcgatgtgctg
gaagtcctcgtgaaagagggtgacaccatcgccaaggatcaagggatcctcgaaatcgag
accggcaaggcgaccatgcaggtcccgagctcggccgctggcaaggtgatcaaggtccac
gtcgcagccggccaaaaagtgtcggtcggcacgctcgttctcacgctcgaaggtgcgggc
gctccagccgctgctcctgcagcagcaccagccgcccccgcagcagctccgcctcctaaa
ccggctcccgtcgcggaagctccgaagccagccgccgcgccagctccagctcctcccaag
gtggctccggcaccagttcagccgctccgtcctgccgctcccgccccagtgcccgtagct
gcggaacctgccctcgaagctgctgtcgtcactgaaaacctcaccgaagccgaagttgct
gccggccctgccgttcgccgctttgctcgcgaagtgggtgtcgacctcgctcgcgtcacc
ggaactggccccggcggacgcatcacccgcgacgatgtcctcgcggtcgttcgtcaagct
gcccaagctgccacttcccccgccaaaccagccgctgcttcgacctcggcaccagctgcc
gctgcacccgccgcgcctgcggctgctccagccgaccgcgacaactggggcccgatccgc
gtcgagaagatgacgaagatccgcaaaaccattgcggccaagatgcacgaatcgtggagc
agcgttcctcgcgtcaccaacttcgacgacgccgacatcaccgaactcgagcggattcgc
caatcgagcaaagacgactacgctcgcaaggggatcaagctcacctcgatgccgtttgtg
atcaaagcggtcgcgatggccctgaaacagcaccctgcgatcaacgccgctatcgatcct
tcgggcgagtcgatcatctacaagcagtacgtcaacatcggcatcgcagtcgacaccgag
cgtggtctggtcgttcctagcctccgtggcatggacgcgctcagcatccccgaaattgcc
cgctcgctcgccaccctggccgacaacgtgcgcgacaacaacttctcgatggccgacctg
caagggagcacgttcaccatcagcaacctcggcgcagtcggcggcacctacagcacgccg
atcgtcaacactcctgaagttgcaatcttgctgctcggccgctcgcgcaagaagccggtc
gtcatcgacgacgaaattcagatccgcatgatgatgccgctgagcctttcgtacgatcat
cgcctcgtcgacggcgctaccgccgcccgcttcctgaacgacgtgatgggctaccttaaa
acccccagccgactcctcctcgccccgtga

DBGET integrated database retrieval system