KEGG   Pirellula staleyi: Psta_4644Help
Entry
Psta_4644         CDS       T01147                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
psl  Pirellula staleyi
Pathway
psl00860  Porphyrin and chlorophyll metabolism
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psta_4644
Enzymes [BR:psl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Psta_4644
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Psta_4644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase Cys_rich_FGFR
Motif
Other DBs
NCBI-ProteinID: ADB19286
UniProt: D2R7V5
Position
complement(6041927..6043444)
Genome map
AA seq 505 aa AA seqDB search
MEPSGSTGKVYLVGGGSGDPGLLTLRGQQCLALADVVMYDYLVNPVLLRHCRPEAKLVCL
GQHGRSRIWPQDEINAHLIAYARAGNAVVRLKSGDPAVFARGAEECLALRQAAIEFEMVP
GITAAIAAASFAGIPITHRDHASAVALVTGHEKADKEGPAVDYKKLAQFPGTIVFYMGVT
SAGEWSRDLLSEGKPASTPIAIVRRVSFPDQSIHLTTLGDVAQFVKQTGLRPPVVFIVGE
VVNLRDELTWFDRRPLFGTTVLVTRPAQQAESLARPLEELGAAVLLDPAIVIGMPEDSAP
LVQAIHTLETYDWLVFASASGVEKFFEQLISLGYDLRKLAHIRLAVVGSGTSAALEKLHL
RADLVPENFEAESLAAMLAPEAAGKRVLIVRASRGREVLPQLLANSGAGVEQVVAYESVD
NLVPDPLVVQRLTERKIDYISVTSSAIATSLVNRYGDLLRSAKLASLSPITSATIRSLGH
EVAVEATLYTMAGLVEAIMHDRAQQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagcggatccacaggtaaggtctatctcgtcggcggtggttctggcgatcca
ggactactcacattgcgcggccagcaatgcctcgcgctggccgatgtggtgatgtacgac
tatctggtgaaccctgttctgctccgtcattgtcgccccgaagcgaagctggtttgcctg
gggcagcatggccgcagccgcatctggccgcaggacgaaatcaacgcgcatctgattgct
tatgcacgcgcgggtaacgcagttgtgcggctgaagagtggcgatcctgccgtgtttgct
cgcggcgctgaagagtgcctggcactgcgtcaggcagcgatcgagttcgagatggttccg
ggcatcacagccgccatcgccgcagctagtttcgctggcattccgattacgcatcgcgat
catgcgtcggctgtcgcgctcgtcaccggtcacgaaaaagccgacaaagaagggcctgca
gtcgattacaaaaaactcgcgcagtttccgggaaccattgtcttctatatgggggtaact
tccgcaggggagtggtcgcgcgatttactgagcgaaggcaaaccagcatcgactccgatc
gccattgtgcgccgtgtaagctttcccgatcagtcgattcatctcaccacgcttggcgac
gtcgcgcagttcgtcaagcaaaccggtctgcgaccacccgttgtgttcatcgtcggagaa
gtggtgaacctgcgcgacgaactcacctggttcgatcgtcgcccactctttggaacgaca
gtgctcgttacacgccccgcacagcaagcggaatctctcgcgcggccgctcgaagaactc
ggagctgcggtactgctcgatcctgcgatcgtgatcggaatgcccgaggattcagcgccg
ctggtgcaggccattcacacactcgaaacttacgactggctcgtgtttgcgagcgccagt
ggtgttgagaaattcttcgagcagctgatttcgctcggctacgacctgcgtaaactcgcc
cacattcggctggcagttgtggggagcggtacttcagcggcactcgaaaaattgcatctc
cgcgccgatctcgtacccgagaacttcgaggccgaatcgctcgcagcaatgctcgcccct
gaagcggctggcaagcgagtcttaatcgtgcgggctagccgcggtcgcgaggttctgcct
caactactagccaactcgggcgcaggggtcgagcaagtggtcgcgtatgaaagtgtcgat
aaccttgtgcccgatccgctcgtagtccagaggctcactgagagaaagatcgactacatc
tccgtcaccagttcggcgatcgccacttcgctggtgaaccgatatggcgatttgctacgg
agtgccaaactagcttcactcagcccgattacgagtgcgaccattcgaagcttggggcac
gaagtcgctgttgaagccacgctctacaccatggcagggctggtcgaagccatcatgcat
gatcgagcccagcagtga

DBGET integrated database retrieval system