KEGG   Pseudoalteromonas sp. SM9913: PSM_A0662
Entry
PSM_A0662         CDS       T01374                                 

Definition
(GenBank) Glycoside hydrolase, family 3
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00460  Cyanoamino acid metabolism
psm00500  Starch and sucrose metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_A0662
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PSM_A0662
Enzymes [BR:psm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     PSM_A0662
SSDB
Motif
Pfam: Glyco_hydro_3 Exop_C Glyco_hydro_3_C
Other DBs
NCBI-ProteinID: ADT67612
Position
I:705456..707972
AA seq 838 aa
MIIKRTFSVTALMLAAIASSGCSQPSNSASDATNQKEIWPTIETGIKSDAQMEQKIADML
KTMTLEQKIAQMIQPEIRHITVEDMRKYGFGSYLNGGGSFPNNNKHATPEDWVDLAEKMY
QASIDDSLDGSTIPTMWGTDAVHGHNNVIGATLFPHNIGLGAANNPELIEKIAAATAREV
MVTGIDWVFAPTVAVVRDDRWGRTYEGYSEDPEIVKAYSASIVKGLQGAVDEDFLSDTRV
VSTVKHFLGDGGTVNGDDQGNNIASEEELYALHAQGYVGGLGAGAQTVMASFNSWHGEKI
HGSKYLLTDVLKDKMGFDGFVVGDWNGHGQVKGCSNSNCAQAANAGLDVYMAPDEWKPLF
SNLVNQANSGEIPLSRINDAVTRILRVKMRAGLFDKPSPAKRPLSGKTEIIGSSDHRAVA
KQAVRESLVLLKNKQQLLPLSPKTNVLVAGIGADNIGMQSGGWSVTWQGTGNKNSDFPGG
SSIYAGIKDTVEQAGGSAALSVEGEYTARPDVAIVVFGEQPYAEGNGDVDNLEYQRGNKS
DLALLRKFKDEGIPVVSLFISGRPMWVNAELNASDAFVAIWLPGSEGDAISDVLFKNADG
SINHDFKGKLSFSWPNNPIDNENRNDEAYSPLLPYGFGLTYNDSNVLKDDLVEQTQQTEK
LDDLVLFERAIKAPWSLVLKSGEQQKTVASSRESLGAVSIQTFDKEVQEDARAIRFNGQA
MAGVNLAAAFPSDLRSYVENNGQLQIQIKVDKAAASPLWVGMGCGESCQGKFDITDNLEQ
SGQWQTLNINLSCFAEQGVDLAQVFTPWQLSTQGDWHVSIAKLAITANAVEQSSVTCK
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgattattaaacgaactttttcagtcactgcactgatgctagcagcaatagccagcagc
ggttgttcgcaaccctctaacagtgctagcgatgcgacaaatcaaaaagaaatttggcca
acaatagaaaccggtattaaaagcgatgctcaaatggagcaaaaaatcgcagatatgcta
aagaccatgacactagagcaaaaaatagcgcaaatgatccaacctgaaattcgtcatatt
acggttgaagatatgcgtaaatatggctttggctcctatttaaacggcggtggctcgttt
ccaaataacaataaacatgcaacccccgaagactgggttgatttagctgaaaagatgtat
caagcgtctattgatgattccctcgatggcagcacgattcctacaatgtggggcactgat
gcggtacatggacacaacaatgtgattggtgcgactttatttccgcataatattggttta
ggggcggcgaacaaccctgaacttattgaaaaaattgccgcagcaacggcgcgtgaagtt
atggttaccggtattgactgggtatttgcacctacggttgccgtagtgcgagatgatcgt
tggggtcgtacttacgaggggtattctgaagaccctgaaatagtaaaagcatattcagcc
tcaattgttaaaggcttacaaggcgctgttgatgaagactttttatcagatacgcgggta
gtcagtacggttaagcattttttaggtgatggcggtactgtgaatggcgatgatcaaggt
aataatatcgcctctgaagaagaattatatgcgcttcatgctcaaggttatgttggtggt
ttgggtgcaggtgcacaaacggtaatggcctcgtttaatagctggcatggtgaaaaaatt
cacggcagtaaatatttactgaccgatgtgcttaaagataaaatgggttttgatggcttt
gttgtcggtgactggaatggccacgggcaggttaaaggctgttctaatagtaactgtgct
caagcggctaatgcgggcttagacgtatacatggcaccggatgagtggaaaccattattt
agcaacttggttaaccaagctaatagcggtgaaatcccactcagtagaattaatgatgca
gtaacgcgtattttacgcgttaaaatgcgtgcagggttatttgataaaccaagccctgcg
aagcgtcccctgtctggaaaaactgaaattattggtagtagcgatcaccgtgcagtggct
aaacaggctgtacgcgagtctttagtattacttaaaaataagcagcagttactgccatta
tcacctaaaaccaacgtattagtcgcaggcataggggctgataacataggtatgcagtcg
ggtggttggagcgttacgtggcaaggtacaggtaataaaaacagtgattttcctggtggc
agttctatttatgcaggtattaaagatactgtagagcaagctggtggcagtgcagcgctg
agcgttgaaggggaatatactgcacgccctgatgttgccattgtggtgtttggtgagcaa
ccatacgcagagggtaatggtgatgttgataacctcgaataccagcgcggtaataaaagc
gacttagcgttactgcgtaagtttaaagatgagggaatccctgttgtttcattatttata
agcggtcgccctatgtgggttaatgctgagcttaacgccagtgatgcgttcgttgctatt
tggcttccaggtagtgaaggcgatgctattagcgatgtcttgtttaaaaatgcagacggc
tctattaatcatgactttaaaggcaagctatctttttcatggcctaataatccaatcgat
aatgaaaaccgtaacgacgaagcttacagcccattacttccttatggttttggtttaact
tacaacgatagtaatgtcttaaaagatgacttggtggagcaaactcaacagactgaaaaa
ttggatgatttagtattgtttgagcgtgcaattaaagcaccgtggtcactggttttaaaa
agtggcgagcaacaaaaaacggtggcgagcagtcgcgagtcattaggtgcggtgagcatc
caaacatttgataaagaggtgcaagaagatgcacgcgctattcgttttaatggccaagca
atggctggcgttaatttagcggctgcgtttccatctgacttacgttcatacgttgaaaac
aatggtcagctgcaaatacaaattaaagtagataaagccgcggctagtccgttatgggtt
ggtatggggtgtggtgagagttgtcagggtaagtttgatattactgataaccttgagcaa
tcaggtcaatggcaaacattaaacatcaacttaagttgttttgcagagcaaggtgttgac
ttagcacaagtgttcaccccttggcagttaagcacgcaaggtgattggcatgtatctatt
gctaagctggctattacagcaaatgctgtcgagcaaagtagtgttacttgtaagtag

DBGET integrated database retrieval system