KEGG   Pseudoalteromonas sp. SM9913: PSM_A0957
Entry
PSM_A0957         CDS       T01374                                 

Definition
(GenBank) enzymatic protein
  KO
K01838  beta-phosphoglucomutase [EC:5.4.2.6]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_A0957
Enzymes [BR:psm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.6  beta-phosphoglucomutase
     PSM_A0957
SSDB
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Other DBs
NCBI-ProteinID: ADT67905
Position
I:1020696..1021352
AA seq 218 aa
MSIEAVLFDMDGTLVDSESVHYICWSQLLAPFGVRYDEDDFCQRFSGRPTIDAAKEIKQT
HNLSVSSRYLADEKYRLFSKFVQTNLPPLMPYAADILFAVKEQGLKMALVTGSARHEAEP
ILKGLGFYDLFDTVVTKDDVTNPKPAGDPYLLALKNMQVAAKNAIAVEDTFTGVTAANNA
ALAVVAIANKHTEQHDFSKATQQMDNLEEFWQWLQSQL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtctattgaagcggtattatttgatatggatggcacgttagttgattctgaaagtgtg
cattatatctgttggagccaattacttgcgccttttggtgtgcgttatgacgaagatgat
ttttgccagcgcttttctgggcgccccacgattgacgctgcaaaggaaataaaacaaacc
cataacttgtctgtgagtagtcgctatttagcggatgaaaaataccgtttgtttagcaaa
ttcgttcaaaccaatttaccgcctttaatgccttatgctgcagatattttattcgcggtt
aaagagcaaggcttaaaaatggcgttagtaacaggcagcgcacgccatgaagctgagcca
atactaaaaggattagggttttatgatttatttgatacggtggttacaaaagacgatgta
accaatccaaagcctgccggtgatccctatttattagcacttaaaaatatgcaggtcgct
gcaaaaaatgcgattgccgttgaagataccttcactggtgtaacagcagcaaataatgca
gccttagccgttgtagcgattgctaataagcacaccgagcagcacgacttcagtaaagca
acacagcaaatggataaccttgaagaattttggcaatggcttcaatctcaactatag

DBGET integrated database retrieval system