KEGG   Pseudoalteromonas sp. SM9913: PSM_A1265
Entry
PSM_A1265         CDS       T01374                                 

Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00040  Pentose and glucuronate interconversions
psm00052  Galactose metabolism
psm00500  Starch and sucrose metabolism
psm00520  Amino sugar and nucleotide sugar metabolism
psm00541  O-Antigen nucleotide sugar biosynthesis
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Module
psm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
psm_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSM_A1265
   00052 Galactose metabolism
    PSM_A1265
   00500 Starch and sucrose metabolism
    PSM_A1265
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_A1265
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    PSM_A1265
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSM_A1265
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Other DBs
NCBI-ProteinID: ADT68204
Position
I:1362762..1363658
AA seq 298 aa
MKVLKAVLPVAGLGTRMLPATKATPKEMLPLVDKPLIQYVVNEAVKAGIKEIVLVTHASK
NAIENHFDTSFELEATLEARVKRSLLEEVRSIIPRDVSIISVRQSAPLGLGHAILETRPI
IGNNPFAILLPDVIIDQYKSNLKVDNLAQMIDRFERTQHNQIMVEPVPQDEVHNYGVVDL
AGKKIHPGENAAITNMVEKPNNDEAPSNLAITGRYVVSPAIWDLLEYTPPGAGGEIQLTD
ALLQLRHLETIEAYHLKGRSHDCGSKLGYMLANVEYAMQSNIMGEEFTKRVKQLMANA
NT seq 897 nt   +upstreamnt  +downstreamnt
gtgaaagtattaaaagcagtcttgcctgttgcaggtttgggtacacgcatgttgccagct
acaaaagcaacgccaaaggaaatgcttccgttagtcgataaacctctcattcaatacgtt
gtaaacgaagcagtaaaagccggtattaaagaaattgtactggttactcatgcttctaaa
aacgcaatagaaaatcattttgatactagctttgagctagaagccactctagaagcgcgc
gtaaaacgtagtctgctagaagaagttcgttcaataatcccgcgagatgtaagcattata
tcggttcgtcaatcggcgccgttaggcttaggccacgcaatacttgaaactcgcccaatc
attggcaataacccttttgctattttattgcccgatgtaattatcgatcaatataagtca
aatcttaaggttgataacctagcgcaaatgatcgaccgatttgagcgcacccagcataat
caaattatggttgagcccgtcccacaggacgaagtgcacaactatggtgtggttgattta
gcaggtaaaaaaatccatcctggtgaaaatgcagccattaccaacatggttgaaaagcca
aacaatgacgaagcacccagtaatttagccataacagggcgttatgttgtttcgcctgct
atttgggacttactcgaatatacccctcccggtgctggcggcgaaatacaattaacagat
gcattactacagttacgtcatcttgaaacaattgaagcgtatcatctaaagggtaggtca
cacgactgcggctcaaaactaggctatatgctcgcaaacgtagagtatgcaatgcaatca
aacataatgggtgaagaatttaccaagcgcgttaagcaattaatggcaaatgcataa

DBGET integrated database retrieval system