KEGG   Pseudoalteromonas sp. SM9913: PSM_A1356
Entry
PSM_A1356         CDS       T01374                                 

Definition
(GenBank) PTS system protein
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00010  Glycolysis / Gluconeogenesis
psm00500  Starch and sucrose metabolism
psm00520  Amino sugar and nucleotide sugar metabolism
psm01100  Metabolic pathways
psm02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSM_A1356
   00500 Starch and sucrose metabolism
    PSM_A1356
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_A1356
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    PSM_A1356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_A1356
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     PSM_A1356
Transporters [BR:psm02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    PSM_A1356
   N-Acetylglucosamine-specific II component
    PSM_A1356
   Maltose/glucose-specific II component
    PSM_A1356
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component
    PSM_A1356
   Trehalose-specific II component
    PSM_A1356
   N-Acetylmuramic acid-specific II component
    PSM_A1356
   Alpha-glucoside-specific II component
    PSM_A1356
SSDB
Motif
Pfam: PTS_EIIA_1
Other DBs
NCBI-ProteinID: ADT68290
Position
I:complement(1462046..1462543)
AA seq 165 aa
MKSEDVSYLTKNKIGRNAIQITSPFSGKVMPMEEHPQPFFRFGTLGPGIVVSLSSHKVLA
PFNGTLLQVKSAGCEFILKANNGLKVLINLAVPDSQTLTHTHIAQLNGSKITKGQRLAYF
DLRELDSPILASLIILNGHNLGTFHYSHPQVNAGVDTLLTIIKKK
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaaatctgaagacgttagctatttaactaaaaataaaattggccgaaacgcgatacaa
atcacgagtccgttcagtggtaaagtgatgccaatggaagagcatccacaaccctttttt
cgttttggcacactcggcccaggtattgttgttagcttatcgagtcataaagtattagcg
ccctttaatggcaccttactgcaagtaaaaagtgccggttgtgaatttattttaaaagcc
aacaacggcttaaaagtattaataaatctagcggtgcccgattcacaaactcttacgcat
actcatattgctcagcttaacggcagcaaaataaccaaaggccaacgccttgcctatttt
gatttacgtgagctcgactcgcctattttagccagccttataattctcaatggccataat
ttaggcacttttcattattctcacccgcaagttaatgccggtgtagataccttattaact
attattaaaaagaagtag

DBGET integrated database retrieval system