KEGG   Pseudoalteromonas sp. SM9913: PSM_A1361Help
Entry
PSM_A1361         CDS       T01374                                 

Definition
(GenBank) putative 23S rRNA m1G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psm03009]
    PSM_A1361
Enzymes [BR:psm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     PSM_A1361
Ribosome biogenesis [BR:psm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PSM_A1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_32 MTS PrmA Methyltransf_23 Methyltransf_8 MetW FtsJ CMAS Methyltransf_9 Methyltransf_4 TPMT Ubie_methyltran Methyltransf_5 Methyltransf_33 Methyltransf_18 Pox_MCEL AdoMet_MTase
Motif
Other DBs
NCBI-ProteinID: ADT68295
Position
I:complement(1467207..1468010)
Genome map
AA seq 267 aa AA seqDB search
MSLHYHCPICKLPLALNEKTLRCDNNHSFDFAKEGYVNLLPVQNKNSKQPGDSLEMVQAR
RSFLEQGHYAFLQTALANLVKPLNANIVIDLGCGEGFYTHAIANNTQATVYGVDISKSAV
KYAAKRYKQCQFSVASISHAPFNDHLADVLISVFAPLFDDELSRLVKEDGCLVVASPGPM
HLKELKKYIYNTVNEHTEVATPTGFKQSSQQLITEQVSLTFSDVRNLIMMTPFAWKFRPE
HWQALEQKQHHKVTLSFYISQFVKTAL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcattaccattgccctatttgcaaacttccattggcacttaatgaaaaaaca
ttacgttgtgataataatcacagctttgattttgccaaagaaggctatgtaaacttactc
cccgtgcaaaataaaaactctaaacagcccggtgactctttagaaatggtacaagcaagg
cgttcttttttagagcaaggccattatgcatttttacagacagccttagctaatttagtc
aaaccgctcaatgcaaatatagtgattgatttagggtgtggcgagggattttacacccat
gctatagcaaataacacgcaagctactgtgtatggtgttgatatatctaagtcggcggta
aaatacgcagcaaaacgatacaaacaatgtcaatttagcgtggcatcaataagccacgcg
ccctttaatgatcaccttgctgatgtgttaattagcgtgtttgcccctttgtttgacgat
gaactttctcgccttgttaaagaggatggctgtttagtggtggcaagccctgggcctatg
cacctcaaagagttgaaaaaatatatctataatacggtaaatgaacatactgaagttgct
acgccaacaggctttaaacaatcatcgcaacagctcattacagagcaagtgtcactcaca
tttagcgacgtaagaaatttaataatgatgacaccctttgcatggaagttcagacccgag
cattggcaggcacttgaacaaaaacagcatcataaggttaccttgtcattttatattagc
cagtttgttaaaactgctctttag

DBGET integrated database retrieval system