KEGG   Pseudoalteromonas sp. SM9913: PSM_A1376
Entry
PSM_A1376         CDS       T01374                                 

Definition
(GenBank) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00052  Galactose metabolism
psm00500  Starch and sucrose metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PSM_A1376
   00500 Starch and sucrose metabolism
    PSM_A1376
Enzymes [BR:psm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PSM_A1376
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF5348
Other DBs
NCBI-ProteinID: ADT68310
Position
I:complement(1485554..1487194)
AA seq 546 aa
MAQKQWYKGAVIYQVYPRSFQDSNNDGIGDLKGIINRIDYIKSLGVDAIWISPFFKSPMR
DFGYDISDYRDIDPLFGNLDDFDELIAQAHQRDIKIIIDQVLSHTSDQHQWFIDSREDLT
NDKADWYVWADAKEDGTAPNNWLSIFGGGAWQWEPRRGQYYLHNFFTEQPDLNFHNPDVR
QAVLDNVEFWLKKGVDGFRLDAINFCYHDAQLRDNPAKPKEKRQGRGFSEDNPYAFQYHY
YNNTQSENIEFMRDIRTLLNKYPGTVSLGEISSEDSLATMAEYTQGGDKLHMGYSFELLT
DDYSSEYIRNTVTTLEQRMTEGWPCWAFSNHDVERVASRWSETGEVNPAQCKMLTALLAS
LRGSVCMYQGEELGLGEASVAFEDLQDPYGITFWPNFKGRDGCRTPMPWENLDSSHANAH
NAGFSEVKPWLPVDQQHKLQAVAEQENDANSILNAYREFMAWRKNQPVLLEGDIEFIQTA
EPILAFYRTLNEEKMLCVFNLSGAKAELVIDVSIEKEHSALSHYNAQLNNKTLTVEPFGS
YYANCS
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggcccaaaagcaatggtataaaggtgcggttatttatcaggtttatccgcgtagcttt
caagatagcaacaacgatggcattggtgacttaaaagggataattaatcgcattgattac
attaaaagtttaggggtggatgctatctggatctcacctttctttaaatcacctatgaga
gattttggttatgatataagcgactatcgcgatatcgaccccctttttggtaacttagat
gattttgatgagctcattgcgcaagcacatcaacgcgatattaaaattattatagaccaa
gtgcttagtcacacctcagatcaacaccaatggtttattgatagccgtgaagatttaacc
aacgataaagctgattggtatgtatgggctgatgctaaagaagacggaacagcaccaaac
aactggttgtctatttttggtggcggtgcatggcaatgggagccgcgtcgtggacaatac
tacttacataactttttcacggaacagcctgatcttaactttcataaccctgatgttcgc
caagctgtattagataatgttgagttttggcttaaaaaaggcgttgatggttttaggtta
gatgcaattaacttttgttaccatgacgcacagcttcgtgataatcctgcaaaaccaaaa
gaaaagcgtcagggccgtggttttagtgaagacaatccgtatgcttttcagtatcactac
tacaacaacacacagtcagaaaacattgagtttatgcgtgacattcgcaccttactcaat
aaataccctggaaccgtgtcactgggtgaaatttcatctgaagattcattagccaccatg
gcagaatacacccaaggcggcgataaattgcacatgggttacagctttgagctactaact
gatgactactcgagtgaatatataagaaacaccgttactacacttgaacaacgtatgact
gaaggctggccttgctgggcatttagtaaccatgacgtagagcgcgttgcaagccggtgg
agcgaaacgggtgaagtaaaccctgcgcaatgtaagatgttaaccgccctattggcctcg
ttacgtggtagcgtgtgtatgtatcaaggtgaagaactcgggctcggtgaagcaagcgtt
gcgtttgaagatttacaagacccatacggcattacgttttggccaaactttaaaggccgt
gatggttgtcgtaccccaatgccttgggaaaaccttgatagctcacatgccaatgctcac
aatgcgggctttagcgaggtaaaaccgtggttacctgttgatcaacaacacaagctccaa
gcagttgctgaacaagagaatgatgcaaactcaatattaaatgcataccgtgagtttatg
gcctggcgtaaaaaccagccagtattacttgaaggtgatattgagtttatacaaaccgcc
gagccaattttggctttttaccgcacgttaaacgaagaaaagatgttgtgtgtattcaat
ttaagcggggcaaaagcagagcttgttattgatgttagtattgaaaaagagcatagcgcg
ctttctcattacaacgcgcagcttaataataaaacactgaccgttgagccatttggtagt
tattacgccaactgcagttaa

DBGET integrated database retrieval system