KEGG   Pseudoalteromonas sp. SM9913: PSM_A1383
Entry
PSM_A1383         CDS       T01374                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00500  Starch and sucrose metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_A1383
Enzymes [BR:psm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PSM_A1383
SSDB
Motif
Pfam: Alpha-amylase hDGE_amylase MLTD_N
Other DBs
NCBI-ProteinID: ADT68317
Position
I:1498265..1499977
AA seq 570 aa
MKTFTLSALALAIMLTGCQSAPSLNNNTNNTETSQLNTKQQASPWWESAIFYQIWPRSFY
DSDADGHGDFNGMTQKLPYLQELGVNALWLTPMFEAPSYHGYDFTEFYQVENDYGSMAEF
EAFIKAADDKGMKVILDLVINHISSNHEWFQRSAKQEAPYADYFIWRDDMPKAGSGWGHA
WSNNDQPDVVWHWNETRQQYYYGAFGASQPDLNLRHPDVIAEMEKMAKFWLDKGVAGFRL
DAVRFAMESGGNAQADTDETIAYWQHFNQYVKSVNPEAYLVGEAWADIPVAAKYFGEGKG
LDQGFDFEVGYKILGLLKPDASGEAQFGTMQSNQQVNTVDANVLKQNLQQRIDSVAPLDF
FAPFLTNHDQERVAYQLAEHDDKAKLAAAMLFSSPGTPYIYYGEEIGLTQGGTGHDVYKR
APMQWDNSNQAGFTQAQTSWVEQAELFGDNYTQWWPEFLAQQINAADRNVKTQQAQSNSI
WRLYQHLIALKKQRPELGIKGRYELTQHNNGLVEITRELNGSKSMFVLNLTANPQSISGI
KRQGLTPSWQHDLNGEQLAGYGLLLLNNTL
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgaaaacatttaccttgagcgcattagcattagcaatcatgctaacaggctgccaaagc
gcaccatcattaaataacaacacgaataacaccgaaacatcgcaattaaatactaaacaa
caagcaagcccgtggtgggaaagcgccattttttaccaaatttggccacgcagcttttac
gatagcgatgctgatggtcatggcgactttaacggtatgacccaaaagctcccgtattta
caagagctcggcgtaaatgcactgtggttaacccccatgtttgaagcaccgtcgtatcat
ggctatgattttactgaattttaccaagtagaaaacgactacggcagcatggccgagttt
gaagcctttataaaagccgctgatgataaaggcatgaaagtcatacttgatttagttata
aaccatatatcaagtaaccatgaatggtttcagcgttcagcaaaacaagaagccccttat
gcagattactttatttggcgcgacgatatgccaaaagccggaagtggttgggggcatgca
tggagtaataacgaccaacccgatgtcgtatggcattggaatgaaacacgccagcagtat
tactatggtgcgtttggagcaagccaacctgatttaaatttacgccacccagatgttatt
gctgaaatggaaaaaatggctaagttttggcttgataaaggcgttgctggttttaggtta
gacgcagttcgctttgccatggaaagcggcggcaatgcgcaggccgacacagacgaaacc
atagcttactggcagcactttaatcagtatgtaaaaagtgtaaaccctgaggcctattta
gtcggtgaagcctgggcagatattcctgtggcggcaaaatactttggcgaaggtaaaggg
cttgatcaaggctttgattttgaagtgggctataaaatactgggcttattaaaacccgac
gccagtggtgaagcgcaatttggcaccatgcaatctaatcaacaagtgaatacagttgat
gccaatgtgctcaaacaaaatttacagcaacgtattgactcagtcgcaccgcttgatttt
tttgcaccgtttttaactaaccacgaccaagagcgtgtggcttatcaacttgctgaacac
gacgataaagcaaaacttgctgccgctatgttatttagctctcctggcacgccgtatatt
tattacggtgaagagataggcttaacacaaggtggcacaggtcacgatgtgtataaacgt
gcgcctatgcaatgggacaacagcaatcaagccggttttactcaagctcaaacaagttgg
gttgagcaggctgaactgtttggtgacaactacacccagtggtggcctgaatttttagca
cagcaaattaatgctgctgatcgcaatgtaaaaacgcaacaagcgcaatctaattcaatt
tggcgtttatatcagcacttaatcgcactaaaaaaacagcgcccagaactgggtattaaa
ggtcgttatgaattaacacagcataacaacggccttgtcgaaataacccgcgagttaaac
ggcagtaaaagtatgtttgtacttaacttaaccgctaacccgcaaagcatcagcggtata
aaacgtcaggggttaacgcctagctggcaacacgacctcaatggcgaacaactcgctggc
tatggtttgttgttactgaataacacactataa

DBGET integrated database retrieval system