KEGG   Pseudoalteromonas sp. SM9913: PSM_A1499Help
Entry
PSM_A1499         CDS       T01374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00071  Fatty acid degradation
psm00072  Synthesis and degradation of ketone bodies
psm00280  Valine, leucine and isoleucine degradation
psm00310  Lysine degradation
psm00362  Benzoate degradation
psm00380  Tryptophan metabolism
psm00620  Pyruvate metabolism
psm00630  Glyoxylate and dicarboxylate metabolism
psm00640  Propanoate metabolism
psm00650  Butanoate metabolism
psm00900  Terpenoid backbone biosynthesis
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm01130  Biosynthesis of antibiotics
psm01200  Carbon metabolism
psm01212  Fatty acid metabolism
psm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSM_A1499
   00630 Glyoxylate and dicarboxylate metabolism
    PSM_A1499
   00640 Propanoate metabolism
    PSM_A1499
   00650 Butanoate metabolism
    PSM_A1499
  Lipid metabolism
   00071 Fatty acid degradation
    PSM_A1499
   00072 Synthesis and degradation of ketone bodies
    PSM_A1499
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSM_A1499
   00310 Lysine degradation
    PSM_A1499
   00380 Tryptophan metabolism
    PSM_A1499
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSM_A1499
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSM_A1499
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSM_A1499
Enzymes [BR:psm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSM_A1499
Exosome [BR:psm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSM_A1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADT68431
Position
I:1624052..1625233
Genome map
AA seq 393 aa AA seqDB search
MSFESVVIVAAKRTPMGGFMGALSDAQSTELGATAIAGALAQTGLSNDAIDEVIMGCVLP
AGLGQAPARQAMLKAGLALSTGATTINKVCGSGLKAAMLANDLIKAGSIESAIAGGMESM
TNAPYFIPKARGGMRMGHGEIKDHMMSDGLEDAYDNKAMGCFAQDTADEYGIGREQMDNF
ALSSLTKAKAAIENGSFENEITPHTIKTRKGDITVSIDEQPGNARPEKIPSLRAAFKKDG
TITAANSSSISDGGAALILMSESKAKAEGLTPLCKIVAHSTHSQKPSEFTVAPVGAMNSV
LEKAGWTTADVDLWEINEAFAMVTMLAINELKLDENKVNVNGGACALGHPIGASGARILV
TLIHALKNRGLKKGVASLCIGGGEAVAMAVEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcgaaagcgttgtaattgtagcagcaaaacgcaccccaatgggtggatttatg
ggcgcactaagtgatgcgcagtctactgaactaggtgctacagctattgcaggtgcactt
gctcaaacgggtttaagcaatgatgcaattgatgaagtgattatgggctgtgtattacca
gctggcttaggccaagcgcctgcacgtcaagcaatgcttaaagcggggcttgcacttagc
accggtgctaccactattaataaagtatgtggctcgggtttaaaagcagcgatgttagcg
aatgatttaattaaggcgggttctattgaatcagcaatcgctggtggtatggaaagcatg
accaatgcgccttactttattcctaaagcccgtggcggtatgcgtatgggacatggtgaa
ataaaagatcatatgatgagcgatggccttgaagatgcttacgacaataaagcaatgggt
tgttttgctcaagacacagccgatgaatacggtattggtcgtgagcaaatggataatttt
gcattaagctcactgactaaagcaaaagctgcaattgaaaatggtagctttgagaacgag
attactccgcacactataaaaacgcgtaagggtgacatcaccgtttcaatcgatgagcaa
cctggcaacgcacgacctgaaaaaattccaagcttaagagctgcatttaaaaaagacggc
accattactgccgctaactcatcgtctatttcagatggtggcgcagcactgattttaatg
agcgaatcaaaagcaaaagcagagggtttaacgccactgtgcaaaattgtggctcacagc
acgcattctcaaaaacccagtgaatttaccgtagcgcctgttggtgcaatgaacagcgta
cttgaaaaagcagggtggacaaccgccgatgttgacctatgggaaattaacgaagcgttt
gccatggttaccatgctagctattaacgagttaaagcttgatgagaacaaagttaatgtt
aacggtggagcctgtgcattgggtcatcctattggtgccagcggtgcgcgtattttagta
acacttatccatgcacttaaaaaccggggtcttaaaaagggcgtagcctctttatgtatt
ggtggcggtgaagccgttgccatggccgtagaagcactttaa

DBGET integrated database retrieval system