KEGG   Pseudoalteromonas sp. SM9913: PSM_A1607
Entry
PSM_A1607         CDS       T01374                                 

Gene name
pgm
Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00010  Glycolysis / Gluconeogenesis
psm00030  Pentose phosphate pathway
psm00052  Galactose metabolism
psm00230  Purine metabolism
psm00500  Starch and sucrose metabolism
psm00520  Amino sugar and nucleotide sugar metabolism
psm00521  Streptomycin biosynthesis
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
Module
psm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSM_A1607 (pgm)
   00030 Pentose phosphate pathway
    PSM_A1607 (pgm)
   00052 Galactose metabolism
    PSM_A1607 (pgm)
   00500 Starch and sucrose metabolism
    PSM_A1607 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_A1607 (pgm)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PSM_A1607 (pgm)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSM_A1607 (pgm)
Enzymes [BR:psm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSM_A1607 (pgm)
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-ProteinID: ADT68535
Position
I:complement(1723659..1725296)
AA seq 545 aa
MAIHSGAGKTAPQSALVNVPKLVSAYYLNEPDLEQNPEHCVAFGTSGHRGCAYDVKFNES
HILSITQAICDYRKQNDIFGPLFLGKDTHALSEAAFNSAIEVLVANEVQVITQENGDFTP
TPVISHAIVSYNKNHPNELADGIVVTPSHNPPEDGGFKYNPPNGGPADTDVTKWIEDRAN
QLLLEDLVEVELFPFAKASRSGFIRYEDLMTPYIDDLKNIINLKAISDAGIKIGIDPLGG
SGINFWPVIAQKYNLDLTVVNDSVDPRFAFMPLDKDGKIRMDCSSPYSMANLIALKDDFD
LSIGNDPDYDRHGIVTPDGLMNPNHFLAVAIDYLLTHRDWDASVEIGKTLVSSSMIDKVT
ERNKRKVKEVPVGFKWFVEGLNKGKLAFGGEESAGAAFLRFDGTVWCTDKDGFIMGLLAA
EILAVTGKTPSALYKELEQEFGAPLYKRLDAPATPEQKSRLKALSADDVKADTLAGEPIL
QKLTHAPGNNAAIGGLKVVTESGWFAARPSGTEDIYKIYLESFKGEEHLALLEKEAKKLV
DSVIS
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggcaattcattccggcgcaggtaaaactgcaccacaatcggctttagtgaatgtacca
aagttagtgtctgcgtattatttaaatgagcctgacttagagcaaaaccccgagcactgt
gttgcatttggcacctcagggcatcgaggctgtgcctacgatgtaaaatttaacgaatcg
cacatattatcaattacccaagctatttgtgattacagaaaacagaacgatatatttggt
ccgttatttttaggtaaagatacccacgcactgagcgaggcggcctttaactcagcaatt
gaagtgttggttgctaatgaagtccaagttatcacccaagaaaatggtgactttactcca
acgccagttattagccatgctattgttagttataataaaaatcatcctaatgagcttgcc
gatggcattgtagtgactccatctcataatccaccagaagatggcggttttaaatataac
ccgcccaatggcggtcctgcagacacagacgttacaaaatggattgaagacagagccaat
caattattattagaagacttagttgaagtagaactgtttccttttgctaaagcttcacgt
tctggttttattcgctacgaagatttaatgacgccttatattgatgatttaaaaaacatt
attaatttaaaagcgattagcgatgcaggcatcaagattggtattgatccattaggtggc
tcaggcattaacttttggccagtgattgcgcaaaaatataatttagatttaacggtcgtt
aatgacagtgttgatccacgttttgcatttatgccgcttgataaagatggcaaaattcgt
atggattgctcatcaccttattcaatggctaatttaattgcgcttaaagatgattttgat
ttatcgattggtaatgaccctgattatgaccgtcacggcatagtaacaccagatgggtta
atgaatcctaatcactttttagccgtagcgattgactatttactaacgcatcgtgattgg
gatgccagtgttgaaatcggtaaaacccttgtttctagctcaatgattgacaaggtaact
gagcgcaacaagcgtaaagtaaaagaagtacccgttggctttaaatggtttgttgagggt
ttaaacaaaggcaaattggcctttggtggtgaagaaagcgctggtgcggctttcttacgt
tttgatggcacggtttggtgtacagataaagatggctttatcatgggcttactcgccgct
gaaattcttgcagttacaggtaaaacaccgtctgcgctgtataaagaactagagcaagaa
tttggtgcgccactttataaacgcctagatgcgccagcaacgcctgagcaaaagtcgcga
ttaaaagcactcagtgctgatgacgtaaaagcagataccttagcgggtgagcctatttta
caaaagctaactcatgcgccaggtaataatgcagctattggtgggctaaaagtggtaact
gaaagcggctggtttgcggcgcgtccgtcaggtacggaagatatttataaaatttactta
gaatcatttaaaggcgaagagcacttagctttattagaaaaagaagctaaaaaactggtt
gattcagtgattagctaa

DBGET integrated database retrieval system