KEGG   Pseudoalteromonas sp. SM9913: PSM_A1707Help
Entry
PSM_A1707         CDS       T01374                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00260  Glycine, serine and threonine metabolism
psm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01130  Biosynthesis of antibiotics
psm01230  Biosynthesis of amino acids
Module
psm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSM_A1707 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSM_A1707 (trpB)
Enzymes [BR:psm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSM_A1707 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADT68632
Position
I:1831148..1832332
Genome map
AA seq 394 aa AA seqDB search
MQNPAYFGEFGGMFVPELLVPALKQLENEFNKAQKDPEFQAELSKLLNEYAGRPTPLTLT
RNLVKNPKVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKKEVIAETGAGQHGVATALA
CALLGLKCRIYMGAKDVERQQPNVFRMKLMGAEVIPVTAGSGTLKDAVNEALRDWSANYQ
EAHYLLGTAAGPHPFPTIVREYQKIIGEEAKQQVLKAEGRLPDAVIACVGGGSNAIGMFT
DFIDEPSVKLIGVEPAGKGLDTHEHGATICKGTKGILHGTYTYIMQNTDGQIEESYSVSA
GLDYPAVGPQHAFLHETGRAQYVGITDTKALDAFQALAKHEGIIPALESSHALAYALEYA
EEQTQDSIIVINLSGRGDKDLAHVHKVLSEEGQL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatccagcttattttggcgagtttggcggtatgtttgtacccgaactgcttgtc
cctgcgcttaagcagttagaaaacgaatttaataaagcacaaaaagatcctgaatttcag
gcagaactaagtaaattacttaacgagtatgcaggtcgtcctaccccgcttactttaacg
cgtaacttagttaaaaacccaaaagtaaaactgtacttaaagcgtgaagatttactccac
ggtggtgcgcacaaaacaaaccaagttttaggccaagctctgcttaccaaacgtatgggt
aaaaaagaagtcatagctgaaacaggcgccggccagcacggcgttgcaacggcacttgcc
tgtgcgttacttggactaaaatgccgcatttatatgggtgcaaaagatgttgaacgccaa
caaccaaatgtatttagaatgaaactcatgggcgctgaagttattccggtaaccgcaggc
tcgggtacattaaaagatgcggttaacgaggcattgcgtgattggtctgccaattatcaa
gaggctcattaccttttaggtactgcagcaggtcctcacccattcccgactattgtacgt
gaatatcaaaaaattattggtgaagaagcaaaacaacaagtacttaaagccgaaggccgt
ttgcctgatgcggttattgcgtgtgtaggcggtgggtctaacgcaattggtatgtttacc
gattttattgatgagccaagcgttaaactcattggcgttgaacctgcaggtaaagggtta
gacacgcacgaacatggcgcaactatctgtaaaggaacaaaaggtattttgcacggtact
tacacttatattatgcaaaatacagatggccaaattgaagagtcttactctgtatcggcg
ggactagattaccccgcagttggccctcaacatgcctttttgcacgaaactggccgtgct
caatatgtcggtattaccgacaccaaagcacttgatgcctttcaagcattagctaaacac
gaagggattattcctgcgcttgaatcaagtcatgcgctagcctatgccctcgaatatgca
gaagagcaaacgcaagacagtatcattgttattaatttaagtggtcgtggagacaaagac
ttagcccacgtacacaaggtattatcagaggaaggtcaactatga

DBGET integrated database retrieval system