KEGG   Pseudoalteromonas sp. SM9913: PSM_A1888
Entry
PSM_A1888         CDS       T01374                                 

Gene name
pgi
Definition
(GenBank) glucosephosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00010  Glycolysis / Gluconeogenesis
psm00030  Pentose phosphate pathway
psm00500  Starch and sucrose metabolism
psm00520  Amino sugar and nucleotide sugar metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm01200  Carbon metabolism
Module
psm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
psm_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSM_A1888 (pgi)
   00030 Pentose phosphate pathway
    PSM_A1888 (pgi)
   00500 Starch and sucrose metabolism
    PSM_A1888 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_A1888 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psm04147]
    PSM_A1888 (pgi)
Enzymes [BR:psm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     PSM_A1888 (pgi)
Exosome [BR:psm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PSM_A1888 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   PSM_A1888 (pgi)
  Exosomal proteins of colorectal cancer cells
   PSM_A1888 (pgi)
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-ProteinID: ADT68812
Position
I:complement(2026625..2028271)
AA seq 548 aa
MASRSELVSWQALENSAQKMAQTHLKTLFAQDDSRFSQFSTHIPGVLFDYSKQRIDEKVF
AQLISLAKECDIEAWREKMFAGEKINITEDRAVLHTALRNRAHTPLIVDGENITEAVDSE
LAKIKTFVEKVRSGQWLGYTGKAVKDVVSIGVGGSNLGPQTATEALKAVVDKPLSVHYVS
NADGVQIASVLNKVDPETTLFVISSKTFTTSETMTNSKTAVDWFLNSAKDKSAIAKHFVA
VSTNLEKTAAFGISDENVFTMWDWVGGRFSLWSAIGLPIALYAGFEAFEAILEGAFEVDE
HFKSAPLEQNIPLIMALLSVWNTSFLGFDSQAILPYDQALHMLPAYLQQGEMESNGKHVT
FDGQTVPYTTVPIIWGMTGINGQHAFYQCLHQGNVIVPADFIGSVKPQVNVDKHHNILLS
NFFAQTEALMNGVDAQQITADLAAKGKTPAQIEMLLKHKIHQGNRPTTSILLDTVDAKAV
GRLIALYEHKIFCHGILLQICSFDQWGVELGKGLASKIEAELTDDNVVNEHDSSTQGLMA
YYKQHRTQ
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggcgagccgttctgagttagtaagttggcaagcactagaaaatagtgcacaaaagatg
gcacaaacacatctgaaaactttatttgcacaagacgattctcgtttttctcaattttct
actcacattcctggtgtattgtttgattattcaaaacaacgtattgatgagaaagttttc
gctcaattaatctcattagctaaagagtgtgatattgaagcgtggcgtgaaaaaatgttt
gccggtgagaaaataaatatcaccgaagaccgtgccgtattgcacaccgcacttagaaat
cgcgcccatacaccgcttattgttgacggtgaaaatattactgaggcggtcgatagcgaa
cttgctaaaattaaaacctttgttgaaaaagtacgcagcgggcagtggttaggttacacc
ggtaaagcggtgaaagatgtagtgagtattggagtaggggggtcaaatctaggccctcaa
acggcaactgaagcacttaaagcagtggttgataagccgttaagcgttcattatgtttct
aatgctgatggcgtacaaattgcgtcagtattgaataaagttgaccctgaaacaacgtta
tttgttatttcgtcaaaaacctttactacctcagaaaccatgaccaactcaaaaacagcg
gttgattggtttttaaatagcgccaaagataaaagcgccatagcaaagcattttgtggca
gtaagcaccaatttagaaaaaaccgcggcatttggtattagtgacgaaaacgtatttacc
atgtgggattgggttggcggtcgtttttcactttggagtgccattggtttacctattgca
ctttatgccggctttgaagcatttgaagctattttagaaggggcgtttgaagttgacgag
cactttaagtcggcaccgcttgagcagaatattcctttaattatggcgctgttgagtgta
tggaataccagctttttaggatttgattcgcaagctattttaccttacgaccaagcatta
catatgttgcctgcgtatttacaacagggtgaaatggaaagtaacggtaagcacgtcact
tttgatgggcaaaccgtaccttacactaccgtgcctattatttggggcatgacgggaata
aatggccagcatgcgttttatcaatgtttgcaccaaggcaatgtaattgtccctgcggac
tttattggctctgtaaaaccacaggttaacgttgataagcatcacaatattttattatcg
aacttttttgcacaaaccgaagcattaatgaacggggtagatgcgcagcagataaccgct
gatttagcagccaaaggcaaaacgcctgcgcaaattgaaatgctactaaagcataaaatt
catcaaggaaaccgcccaacaacgtctatattattagacacggttgatgcaaaagcggtg
ggtcgtttaattgcactgtatgaacataagattttttgccacggtattcttttacaaata
tgttcatttgatcagtggggcgttgagcttggtaaaggtttagcctctaaaattgaagct
gaattaaccgacgataacgtggttaatgagcacgacagctcaacacagggcttgatggcg
tactacaaacaacaccgtacgcagtaa

DBGET integrated database retrieval system