KEGG   Pseudoalteromonas sp. SM9913: PSM_A1973Help
Entry
PSM_A1973         CDS       T01374                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00900  Terpenoid backbone biosynthesis
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSM_A1973 (ispE)
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PSM_A1973 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C RRM_1
Motif
Other DBs
NCBI-ProteinID: ADT68897
Position
I:2117685..2118542
Genome map
AA seq 285 aa AA seqDB search
MYTHSEFSLIAPAKLNLFLHINGRRDDGYHELETLFTFLNYGDELHFKLSTDTLISISGD
TNGIALTDNLIYKAALLLQTHCKVDMGAKINLTKRLPMGGGVGGGSSDAASTLLALNTLW
NTALSLDELADLGLKLGADVPVFIKGKSAIAHGIGEQLEYLELPPKWYCVVFPNQHVSTA
QIFTHPDLKRDTPKLSGDWQQQILTNDCEPLVKKLCPEVEKTLQWLLKYAPSKMTGTGSC
CFVEFASQVQAQDVLANLPHTWQGFIASSVSTSPAHTELAAIIDK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtatactcactctgaattttcgctgattgccccagccaagcttaatttatttttacac
attaatggccgccgtgatgatggctaccatgaattagaaactttatttacgtttttaaat
tatggtgacgagctccattttaaactaagcacggatactcttataagtattagcggcgac
accaatggcattgcgctaaccgacaatttgatttacaaagcggcgttattattacaaacc
cactgtaaagtggatatgggtgcaaaaataaatttaactaaacgcttacccatgggggga
ggtgttggaggcggttcatccgatgctgcatcaacgcttttagctcttaatacgctttgg
aatacagccctatctttagatgaactggctgatttaggcctgaaactcggtgctgatgta
cctgtgttcattaaaggtaaaagtgccatagcacatggcattggcgagcaattagagtac
ctagaactgccgccgaagtggtattgtgttgtcttcccaaatcaacatgtcagcacagca
caaatatttactcacccagatttaaaacgtgatacaccaaaactttctggcgactggcaa
cagcaaattttaaccaacgattgtgagcctttagtgaaaaagctgtgccccgaggttgaa
aaaaccctgcagtggttgctaaaatacgctccatcaaagatgaccggaacaggttcatgt
tgttttgttgaatttgctagccaagttcaagcacaagatgtacttgctaacctcccccat
acttggcagggttttatcgcatccagcgttagtacctctcctgctcatacggagttagcc
gccatcattgataaatga

DBGET integrated database retrieval system