KEGG   Pseudoalteromonas sp. SM9913: PSM_A2013Help
Entry
PSM_A2013         CDS       T01374                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psm03016]
    PSM_A2013 (truC)
Enzymes [BR:psm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     PSM_A2013 (truC)
Transfer RNA biogenesis [BR:psm03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    PSM_A2013 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 KapB
Motif
Other DBs
NCBI-ProteinID: ADT68936
Position
I:complement(2153106..2153870)
Genome map
AA seq 254 aa AA seqDB search
MSERPEPIEYGELSILYQDENYVAIDKPSGLLVHRSFLDKHETQFAMQMLRDQIGQHVFP
VHRLDRPTSGVLLFALSSEAARDMNQLFIEGTITKRYLALVRGFAPESVFLDKPLKEELD
KIADKFADQDKAAQEAQTQFNCLHQAALPIPIGKYPTVRYSLVECFPKTGRKHQIRRHLK
HLSLPIIGDVNHGDNQHNQFFREHFSLRRLMLFASELSFVHPYNNEPITIKAPLGDAMLN
ICKQLGWPEQEEDY
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcgcccagagcctattgaatacggcgaactgtcgattctttatcaagatgaa
aattatgtagcaatagataaaccctctgggctacttgttcatcgctcatttttagataaa
catgaaactcaatttgcaatgcaaatgctgcgcgatcaaatagggcaacatgtgtttcct
gttcaccgtcttgataggcctacttcgggtgtattactgtttgcattaagctcagaggcg
gcgcgtgatatgaatcaattatttattgagggcacaataacaaaacgttatttagcgttg
gtacgcgggtttgcgcctgaatctgtttttttagataaaccgttaaaagaagaactcgac
aaaatagccgataagtttgctgatcaagacaaagccgcgcaagaagcacaaacacaattt
aattgtttgcatcaagctgcgctgcctatcccaataggaaaatacccaacggttcgttat
tctttggtagagtgttttcctaaaacgggtcgcaaacatcaaatacgccggcatttaaag
cacttgtctttacctattattggtgatgtaaatcatggcgataaccagcataatcagttt
tttagggagcatttttcgcttcgccgtctaatgttgtttgcatcagagcttagctttgtg
cacccttataataatgaacccataacaattaaagcgccgctgggtgatgcaatgttaaac
atttgcaaacagctggggtggccagaacaagaagaggattattaa

DBGET integrated database retrieval system