KEGG   Pseudoalteromonas sp. SM9913: PSM_A2428Help
Entry
PSM_A2428         CDS       T01374                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00330  Arginine and proline metabolism
psm00332  Carbapenem biosynthesis
psm01100  Metabolic pathways
psm01130  Biosynthesis of antibiotics
psm01230  Biosynthesis of amino acids
Module
psm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSM_A2428 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PSM_A2428 (proB)
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PSM_A2428 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADT69342
Position
I:complement(2588109..2589212)
Genome map
AA seq 367 aa AA seqDB search
MQRDQVVVVKLGTSVLTGGTDKLDKAHMVELVRQCCELKKQGHQVILVSSGAVAAGREQL
LKPCGRTLIDKQMLAAIGQGQLIHIWQSLFALYGVNVGQMLLTRADVDDRERYLNARDTL
NALLNYDVVPIINENDAVATSEIKVGDNDNLSALVAILANADKLLLLTDQQGLFTSDPRT
DINATLIDEVTHINDELRQLAGGSGTNLGTGGMATKLQAADIARRAGVEVIIAKGADENV
ILKCMSEQLPGTRFLKLTAPKDGRKKWLLAGPKSSGQILIDAGAVHALQSKGASLLAKGI
TRAIGEFERGDLINLIDVNEQIIARGLTRFSHLEIDKIKGAHSNQISQLLDYDSGVEVLH
RDDMVVL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagggatcaggtagtagttgtaaagctaggtacaagcgtactcactggcggtacc
gataagttagacaaagcacatatggtggaacttgttcgccaatgctgtgagctaaaaaag
caaggtcaccaggttattttagtttctagtggtgcggttgccgcaggtcgcgaacagtta
ttaaaaccctgtgggcgcacattaatagacaaacaaatgttggccgccattggacagggg
cagcttattcatatttggcaaagcttatttgcgttgtatggtgttaacgtggggcaaatg
ctactaacgcgcgccgatgttgacgacagagagcgttatttaaatgcccgcgatactctc
aatgccttattaaattatgatgttgtgccgatcatcaatgaaaacgacgcggttgctacc
agtgaaataaaagtaggtgacaacgataacttatcggcattagtggctattttggccaat
gccgataaattactattgctgaccgatcaacaagggttatttacaagcgatccgcgcact
gacattaacgccaccttgattgacgaagttactcatattaatgatgagttacgccaactt
gcaggtggcagcggtacaaacctaggcacagggggtatggcaaccaaactacaggcagcc
gatattgccagaagagctggggttgaggtgattatcgccaaaggcgctgatgaaaacgtg
attttaaaatgcatgagcgagcaactgccaggcacccgttttttaaaacttaccgcccct
aaagatggccgaaaaaaatggttattggcagggcctaaaagtagcggccaaattttaatt
gatgccggtgcggtgcatgcattgcaatctaagggcgccagtttacttgctaaaggcatt
acgcgtgcaataggtgaatttgaacgcggagatttaattaacttaattgatgtaaacgag
caaattattgcacgtgggttaacgcgctttagccatcttgaaatcgataaaataaaaggc
gcacactctaatcaaatcagccaattacttgattacgacagcggcgtggaagtgctacac
agagatgatatggtggtgttgtaa

DBGET integrated database retrieval system