KEGG   Pseudoalteromonas sp. SM9913: PSM_B0064Help
Entry
PSM_B0064         CDS       T01374                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00630  Glyoxylate and dicarboxylate metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm01200  Carbon metabolism
Module
psm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSM_B0064 (aceA)
Enzymes [BR:psm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSM_B0064 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Myb_DNA-bind_6
Motif
Other DBs
NCBI-ProteinID: ADT70104
Position
II:69602..71203
Genome map
AA seq 533 aa AA seqDB search
MTTYQGETDTLATLCQSQGSAWKTINPEYATRMRLQNRFRSGVDIAQFTADIMREDMAAY
DKDTSQYTQSLGCWHGFTAQQMMMAIKRHQKTTKRSYVYLSGWMVAALRSEFGPLPDQSM
HEKTSVPALIEEIYTFLKQADARELDHLFNELDDAKANGGDVQAVLNKIDNFETHVVPII
ADIDAGFGNEEATYLLAKKMIEAGACAIQIENQVSDAKQCGHQAGKVTVPHEDFLAKINA
VRYAFLELGIDNGIIVARTDSLGASLTQKVPVSKKPGDLASQYNAFLETTPVNSVDDLNE
GETAMKLNGQLCKPTRLDNGLYQFREGTEKDRVVLDCVTSLQSGADLLWIETEKPHVKQI
AELVNRVKEQVPDAKLVYNNSPSFNWTLKFREQVYQEWQEEGRDLSAYPSLDDNKALMAP
EMDATELAAAADLLVQNFQRDGAREAGIFHHLITLPTYHTAALSTDILSEGYFGDLGMLA
YVRDVQRQEIRREQASVKHQDLAGSNIGDTHKEYFSGENALKAGGEANTMNQF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatatcaaggcgaaacagatacactagcaacattatgccaatcacaaggcagt
gcatggaaaacaattaatcctgaatacgcaacacgtatgcgtttacaaaatcgttttcgc
tctggtgttgatattgcacaatttacagcagacatcatgcgtgaagacatggctgcatac
gataaagacacaagccagtacacacagtctttaggttgttggcatggttttactgcgcaa
caaatgatgatggcaattaagcgccatcaaaaaacaactaagcgcagttacgtataccta
agcggttggatggttgcagcgcttcgctctgagtttggtcctcttccagatcaaagtatg
catgaaaaaacatcagtaccggcacttatcgaagaaatctataccttcttaaagcaagcg
gatgcacgtgaacttgaccacttatttaatgaactagacgacgcaaaagcaaacggcggc
gacgttcaagcagtacttaacaaaattgataactttgaaacgcacgttgtaccaattatt
gctgacattgatgccggttttggtaacgaagaagcaacttacctactagctaaaaagatg
attgaagcgggtgcatgtgctatccaaatcgaaaaccaagtatcagatgctaagcaatgt
ggtcaccaagcaggtaaagtgacggttccacatgaagactttttagcaaaaattaacgca
gtgcgttacgcgttcctagagctaggtattgataacggtattatcgttgcgcgtaccgat
tcactaggtgcaagccttacgcaaaaagtaccggtttcaaaaaaaccaggtgacttagca
agccaatacaatgcatttttagaaacaaccccagtaaacagtgttgatgacttaaatgaa
ggcgaaacagcaatgaagcttaatggtcagctttgtaagccaacacgcctagacaatggt
ttataccagttccgcgaaggcactgaaaaagaccgtgtagtactagattgtgtaacgagc
ctacagtcaggtgctgatttactgtggattgaaacagaaaaaccacatgtaaaacaaatt
gctgaactcgttaatcgcgtaaaagagcaagtaccagatgctaaattagtatacaacaac
tcaccatcgttcaactggacgctgaagttccgtgagcaagtataccaagaatggcaggaa
gaaggtcgtgacctgagcgcttacccaagtcttgatgataacaaagcgcttatggctcca
gaaatggatgcaacagagcttgcagcagccgctgacttattagtacaaaacttccaacgc
gatggtgcacgtgaagcgggtattttccaccacctaatcacgttaccaacgtaccacaca
gcagcattaagcacagatattctatctgaaggttactttggtgacttaggtatgctggct
tatgtacgtgatgtacagcgtcaagaaatccgtcgtgagcaagcgtctgttaaacaccaa
gaccttgcaggctcaaacattggcgatacacacaaagagtacttctcaggtgagaatgca
ctcaaagccggtggtgaagctaacaccatgaaccaattttaa

DBGET integrated database retrieval system