KEGG   Pseudoalteromonas sp. SM9913: PSM_B0214
Entry
PSM_B0214         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11899  type VI secretion system protein ImpD
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0214
Secretion system [BR:psm02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PSM_B0214
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ADT70254
Position
II:239867..241393
AA seq 508 aa
MNHEEFSFINQDFTFQQKSQSRISDNDALLDRFLNEKNLDKALLLWLEGSSDSPLSWNKE
SLSPYLQRVIIELDQLISSQLNHIIHAKSFQNLEASWRNLWWLLLQTEQQDKEKKVKVKL
LNCDWPTLSKDVNKAIDFDQSTFFQLLYQNEFDSAGGEPFGIVIGDYEISNGCSAGTIYN
DIDTIKEVSRTAAAAFSPFICSASANLFGADSFSDLGYYSDLFNHFEQPEYIKWQSFRKM
EEARFMGFTLPHVLVRPPYANDGKRHQEFYFKEQIINPETDMLWGNAAYQFVSTIIRAYC
DSGWFGHIRGIEPGKVSKGLVTGLARDSFANDTYQKEAKPPLDLLVTSKFEKQFSELGFI
PASSVTNTEHIVFYSNASVQKTKNYDSSAANINARLSSMLQYILCVSRFAHYLKLLARDR
VGSYSTAQACERDLQAWINNYTTASDSASEHIRSKYPLSNAKIKVSENKANPGHYFSVLQ
LQPHFQLDQMVSSIKLITELSPHHKIKE
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgaatcacgaagagttttcatttatcaatcaagacttcacttttcaacaaaagtcgcag
tctcgaataagtgataatgacgctttactcgataggtttttgaacgaaaaaaacctagat
aaagcgttattattatggcttgaaggctcttctgattctccactttcttggaataaggag
tcattgagtccttatttacagcgtgtgatcattgaactcgatcaactgatttcttcacaa
ctcaatcatataattcatgcaaaaagctttcaaaatttagaagctagttggcgaaatcta
tggtggctattattacaaacagagcaacaagacaaagaaaaaaaagtaaaagttaaattg
cttaattgtgactggccaacgctctcaaaagacgtaaataaagcgatagatttcgatcaa
agtacgttttttcaattactctatcaaaacgaatttgacagtgccggcggcgagcccttt
ggtattgtgattggtgattatgaaattagtaatggttgctcagcgggcactatttataac
gatatagatacgattaaagaagtgtcaagaacggctgccgccgcattttctccttttata
tgttcagcatcggctaacttatttggcgcagatagcttttcagatttaggttattactct
gatttatttaatcattttgagcagcctgaatatataaaatggcaaagctttagaaaaatg
gaagaagctagattcatgggttttacacttcctcatgtgctagttaggccgccttatgct
aatgacggtaagcgccatcaagaattctatttcaaagaacaaattattaatccagaaaca
gatatgctgtggggaaatgcagcctatcaatttgtatcaacaataatcagagcttactgc
gatagcggctggtttgggcatatacgtggtatagagccagggaaagtgtcaaaaggctta
gtcacagggctagctcgcgatagttttgctaatgatacttatcaaaaagaagccaagccg
ccactggatttgttagtaaccagtaagtttgaaaagcaattttctgaactcggttttatc
ccagcctcttcggtcacaaataccgaacatattgttttttacagtaatgcgtcggttcaa
aagacaaaaaattacgattcaagcgctgctaatatcaatgcgcgcttatcgtctatgttg
caatacattttatgtgtatcgcgctttgcgcactatttaaaattattggcccgagaccgt
gtaggctcttacagcacggctcaagcgtgtgaaagagatttacaagcgtggatcaataac
tacacaaccgcgtcagactctgcgtctgagcacattagaagtaaatacccactcagtaat
gcaaaaataaaagtaagtgaaaacaaggctaatccgggtcattacttttcggttttgcag
ttacagcctcattttcagttagaccaaatggtctcgagtattaagttaataacagagctc
agtcctcatcataaaataaaggaatag

DBGET integrated database retrieval system