KEGG   Pseudoalteromonas sp. SM9913: PSM_B0215
Entry
PSM_B0215         CDS       T01374                                 

Definition
(GenBank) virulence protein, SciE type
  KO
K11898  type VI secretion system protein ImpE
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0215
Secretion system [BR:psm02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PSM_B0215
SSDB
Motif
Pfam: ImpE TPR_19
Other DBs
NCBI-ProteinID: ADT70255
Position
II:241396..242175
AA seq 259 aa
MKKIHSLIREGKLADALLCCATELQDEPLNFDIRSLYSELLCINGELEKADKQLDFMVQK
NPEFAVGAVNLRHLIRAQQSRVDFYQGKGIPKLFHEANELDTLFLKMHVALLEGETSEAA
TLAKQMEALRLESVDDEHSAIRDLDDSLSPYLEVLGTNGEFYLANFNEIEALKVEPVTSL
LESIWLRVEITIKDGPSGTAHLPLVYANSNTELEKLGQVSDWDELQDEFIVGKGMKMLFV
NDEAITIPSLKINAVETAE
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaaaaaatacacagtttaattcgcgagggaaaacttgctgatgctttattatgttgc
gctacagagttgcaagatgagcctttaaattttgatattagaagtctttattctgaatta
ctttgcattaacggtgaacttgaaaaagcagataaacagctagattttatggtgcaaaag
aaccctgaatttgctgtaggtgcggttaaccttaggcatttaattcgcgcacaacaatcg
cgtgtagatttttatcaaggtaagggtattcctaaactctttcatgaagctaatgagcta
gacaccttgttcttaaaaatgcacgtagccctacttgaaggcgaaacatctgaagcggca
acgcttgcaaaacaaatggaagcacttcgtcttgaaagcgttgatgatgagcattcagca
attagagatttagatgatagcttaagcccatatttagaagtgctaggcacgaatggcgag
ttttaccttgcaaactttaatgaaattgaagcattaaaagtagaacctgtaacgtcttta
ttagagagcatctggttacgcgttgagatcactatcaaagacggtccgtcaggcacggca
catttaccgctggtttatgcaaactcaaatactgagctggaaaagttaggtcaggtttct
gattgggatgagctacaagatgagtttattgtaggtaaaggaatgaaaatgttatttgtc
aacgatgaagcaatcactattcctagtctaaaaatcaacgccgttgaaacagcagagtaa

DBGET integrated database retrieval system