KEGG   Pseudoalteromonas sp. SM9913: PSM_B0217Help
Entry
PSM_B0217         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0217
Secretion system [BR:psm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSM_B0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ADT70257
Position
II:242673..244499
Genome map
AA seq 608 aa AA seqDB search
MNDELLKYYNRELAFVRHMGKDFSEKYPKVAGRLKLSDDHIEDPHVSRLIESFAFLTANI
RQKLDDSFPELTDALLGQMLPDYQAPIPSMSVVKLEAENLSTTGVVIPRGSEVETNVESM
KQCKFQTCYETYLWPVEITSAQFDNSPFVAPKPRWHEKAKSIFKLELTGEYPGVSLAETG
LEKLRLFINGQWHHTLKVYELLFKHAIGIAFDNGEEGIKYLSKNQLKAVGFDANEAVVPY
SQRSSAGYRLLVENFTFPEKFRFVELENIRSSLPKKSNKCSVYIYLDSESTELEKQVDKN
MFLMGCTPIINMFEQELEPIRPELSEYEYQLTPRYMDSEISEVIGISEVIAFDHKGNKQI
VCPFYGQTHPRYQGHDDLFWHIRRETASWAGGYVESGTESFLSLVDARFENSAMDYAEGN
TVLTVRANCSNRNLPASMPFGDDELGLLMPERGDVIKKIRCLIPFTHAVRPILADATRWQ
LVNHLTLDAFSGDDACNKLKEVLRLYDFRASPQTKGLIDNIYRVIVEPATARVVQKGRVS
FATGSEIEITFANDDFSGSGMFFFASILDHFFAQFAAINSFTRVSLRLKEQEQVYYQWPA
RVGESPLI
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgagttattaaagtactacaaccgcgaactagcgtttgttcgccacatgggt
aaagacttttctgaaaagtaccctaaagttgctgggcgattaaagttaagcgatgaccat
attgaagaccctcatgtatctaggctaatcgaatcgttcgcatttttaactgctaatatt
aggcaaaaacttgatgacagctttcctgagctaactgatgctctattgggacagatgctg
ccagactaccaagcgcctatcccttctatgtcggtggtaaaattagaagctgaaaatctg
tccaccacgggtgtggtcattccaagaggcagtgaagtagaaaccaatgttgagtcgatg
aagcaatgtaagtttcaaacctgttacgaaacttatttatggccggttgagatcacaagt
gcccaatttgataatagtccgtttgttgcccctaagcctcgttggcatgaaaaagctaag
tcaattttcaaacttgagctaaccggtgaatatccgggtgtatcattagctgaaaccggg
ctggaaaaattacgattatttataaatggccaatggcatcatacgcttaaagtgtatgaa
ctattatttaaacacgctattggtattgcttttgataatggtgaagagggtataaagtac
ctttctaaaaaccagttaaaagccgtaggctttgatgcaaatgaagcggtggtgccctat
tcgcagcgctcaagtgctggttatcggttactggtggaaaactttacctttccggaaaag
tttcgctttgttgagcttgaaaatattcgttcatcactgcctaaaaagtctaacaaatgc
agtgtgtatatttatcttgattcagagtcaaccgagcttgaaaagcaagtagacaaaaat
atgtttttaatgggatgtacacccattatcaatatgtttgagcaagaactagaaccgatt
cgccctgagctgagtgaatacgaataccaattaacaccacgctatatggactctgaaatc
tcagaggtgattggtatctcagaagttattgcgtttgatcacaaagggaacaaacaaata
gtgtgtcctttttatgggcagactcatccacgataccaaggccatgatgatttattttgg
cacatccgcagagaaaccgcttcttgggccggtggctatgttgagtcaggtacggaatcg
tttctatcattggtagatgcacgatttgaaaatagcgctatggattatgctgaagggaac
acggtattaacagtacgtgctaattgcagtaatcgaaaccttcctgctagcatgcccttt
ggagatgatgaactcggacttttaatgcctgaacgtggtgatgtaataaaaaaaatacgt
tgtttaatcccatttactcatgcagttagaccgatattagccgatgcaactcgttggcaa
ttagttaatcatttaacccttgatgcgtttagtggagatgatgcatgtaacaagcttaaa
gaagtgttacggctgtatgactttagagcttcaccgcaaacaaaaggccttatcgataat
atttaccgcgtgattgtagaaccagcaacggcgcgtgttgtacaaaaaggacgagtaagc
ttcgcaacgggaagcgaaatagaaattacctttgccaatgatgatttttcgggaagtggt
atgtttttctttgcttctatcctcgatcatttctttgcacaatttgcggcaatcaatagt
ttcacgcgtgttagtttaaggctcaaagaacaagagcaagtgtattatcaatggcctgct
cgagttggggaaagcccgttaatatga

DBGET integrated database retrieval system