KEGG   Pseudoalteromonas sp. SM9913: PSM_B0218
Entry
PSM_B0218         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0218
Secretion system [BR:psm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSM_B0218
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADT70258
Position
II:244463..245485
AA seq 340 aa
MACSSWGKPVNMIQHIISQASQVDFYKAVFIIENQLKKHGLEYRYVGYDSSPKQELIKFT
ATQKFGYPGNAITKLEQASFEDGLHKVNMQISFMGLTGCSGALPQFYSELVMQRLRYKDT
TMRDFYDMFNHRLVSLYYRAWKKYKPSLNHVNKDKNKDPYTQILGLLSGGYNDHQLHFSG
LYSRKIRNAFDLKSVLSSYLGCDVVIKQMVGKWHDLKPQEQTCLASERLYEGQHARLGVD
TVIGKKIWDISSNIEIHISTTDIDKAKSLLPKGKLFELATKIVKDYAGNAISFRLIIESD
FQQLDAVQLSKRECQLGANSFLMASKNTPKFNPIKLSFKG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggcctgctcgagttggggaaagcccgttaatatgatccagcatattatttctcaagcg
tcacaagttgatttttataaagctgttttcattattgaaaaccagctgaaaaagcatggc
ttagagtatcgctatgtagggtatgacagtagcccaaagcaagagttaattaaatttacc
gcaacacaaaaatttggttacccaggtaacgctatcacaaaattagagcaagctagcttt
gaagatgggttgcataaagtcaacatgcagatctcttttatgggattaacgggttgctca
ggtgctttaccccaattttacagcgagctggtgatgcagcgtcttcgctataaagatacc
accatgcgtgacttttacgacatgtttaatcatcgtttggtgtctttatattatcgagcg
tggaaaaaatataagccgtctttaaatcatgtgaacaaagataaaaacaaagacccatat
acacaaatattgggacttttaagtggcggctataatgatcatcagctgcatttttctggc
ttgtatagccgaaaaattcgcaacgcttttgatttaaaaagtgtattgagctcttacctt
ggttgtgatgttgtcatcaaacaaatggtaggaaagtggcatgatttgaagccacaagaa
caaacctgtttagcaagtgagcgcctatacgagggacaacatgctcgcttaggcgttgat
accgtaataggtaaaaagatatgggatatttcttctaatattgagattcatatcagcact
actgatattgataaagcaaaatccttgttaccgaaaggcaagttatttgagttagctacc
aaaattgtaaaagattatgcgggcaatgcgatttcatttcgacttatcatcgaatcagat
tttcaacaacttgatgcggtgcagttgtctaaacgggaatgccaacttggcgctaatagc
tttttaatggcgagtaaaaacacccctaaatttaaccctattaagttatcgtttaaagga
taa

DBGET integrated database retrieval system