KEGG   Pseudoalteromonas sp. SM9913: PSM_B0219
Entry
PSM_B0219         CDS       T01374                                 

Definition
(GenBank) ATPase
  KO
K11907  type VI secretion system protein VasG
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSM_B0219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0219
Secretion system [BR:psm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSM_B0219
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_16 AAA_5 Sigma54_activat AAA_22 AAA_25 TniB AAA_30 AAA_7 NACHT Clp_N TIP49 IstB_IS21 Zeta_toxin ResIII AAA_14 AAA_18 CbiA SRP54 DUF2075 Rad17 RuvB_N AAA_24 LemA Hpr_kinase_C AAA_6 Sigma70_r4_2 Spc7 DUF3966
Other DBs
NCBI-ProteinID: ADT70259
Position
II:245509..248127
AA seq 872 aa
MSTMTLNKLVEKLSPDCRKSLEAAVAICNSRSHFTVELEHWLLAMIEQQLDDVRLIFGSF
DIDIDQVKQDLNQSLESFKTGSDSSPSLSVHVTTLLRQSWLSTSIEFTDEQIRSAYVIYT
LTKDDTLSSLVTRCSKLFNNIEPGQLLHAWPEIVAQSQERNTANVTAATPANGSSKTPSL
DQFTVDLTAQAKAGKIDPILGRDFEIRQMVDILTRRRQNNPILTGEAGVGKTAVVEGLAL
RIAQKDVPAVLQNVKLHSLDLALLQAGAGMKGEFENRLKSLINEVKNAVDPVILFIDEAH
TMIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKFFEKDAALTRRFQVVKVEEP
TPEKAVAMLRGLVPVMEKHHKVFISEQALESAVHLSHRYITARQLPDKAVALLDTACARV
AMSQASTPNAIEQLMNRLSEIEAQVLMLNREQKTGLDHSEQLSALKSELVEIEQQLEPLN
EQFNVEKGIVAELNQALESINTNDADSSAEVLEQLKESKLKLASYEHNMVHWQVDEELIA
QVISDWTGIPVGKMHEDEIHGILNLAAQMKQRVVGQDHALELMAKVVQTSRAQLADESRP
NGIFMLAGPSGVGKTETALSLAQEVYGSEDNVTVINMSEFKEEHKVSLLLGSPPGYVGYG
EGGILTEAVRRKPYSVVLLDEMEKAHPGVQDIFYQVFDKGTIKDGEGRDIDFKNTIIIMT
SNVGTDTTMSLFEDEESKPSIKGLLKALQDDLLGAFKPAFLGRINVIPYIPLSDEILTQI
AALQISKIIKRVKKHYDAQLTYNDDVIEHIIANCQNAGSGARNIHTILQNKVLPLLSEIL
LSSMVEGEKVTSISLLIKDNEFDVELTKVNSK
NT seq 2619 nt   +upstreamnt  +downstreamnt
atgtcaacgatgacattaaataaattagttgaaaaactaagtccagattgtagaaaaagc
ttagaggcagctgttgcaatatgtaatagccgcagccattttacggttgaattagagcat
tggttgttagccatgattgagcagcaactagacgatgttagactcatattcggttctttc
gatattgatattgatcaggtgaagcaagatttaaaccaatcactagagtcatttaaaacg
ggcagtgattcatcgcctagcctatcagtgcatgtgactacattattaaggcagtcatgg
ttaagtaccagtatagaattcaccgatgagcaaattcgcagtgcttatgttatttatacg
ctaacaaaagacgatacgctttcaagtttagtaacgcgctgtagcaaattgtttaataac
atagagccaggccaactgttacatgcatggcctgaaattgttgcacaatcgcaagagcga
aataccgccaatgtaactgctgcaacacctgcaaatggttcatctaaaacaccgagttta
gatcaatttacagttgatttaaccgctcaagcaaaagcggggaaaatagaccctattcta
ggtcgtgattttgaaatacgtcaaatggttgatattttaactagacgtcgtcaaaacaac
ccaatcttgacgggtgaagcgggtgtaggtaaaaccgctgtggttgaaggacttgcccta
agaattgcccaaaaagacgtacctgcagtattacaaaacgttaagttgcacagcctagat
ttggctttgcttcaagcaggtgcgggcatgaaaggtgagtttgaaaatcgcttaaagtcg
ttaattaacgaagttaaaaacgctgttgaccctgtgattctttttatagatgaagctcac
actatgattggtagtggcggacaagcgggtcaaaacgatgcggctaacttactaaaacct
gctttagcaagaggggaattacgtactattgcagcaacaacgtgggctgaatataaaaag
ttttttgaaaaggatgctgcactaacacgtcgtttccaagtggtaaaggttgaagagcca
acgccagaaaaagcggttgctatgctacgtggtttagttcctgttatggaaaagcatcat
aaagtttttatttcagagcaagcacttgaaagtgcggtgcatctatcgcacagatacatt
actgccaggcaacttcccgataaagcagttgcattgttagatacggcctgtgctcgtgtt
gctatgagccaagcatcgacacctaatgcgattgagcagttaatgaatagacttagtgaa
attgaagcgcaagttttaatgttaaatcgtgagcaaaaaaccggtttagatcatagcgaa
caattatcagcacttaaatctgaactagttgagattgaacagcaacttgaaccattaaat
gagcagttcaacgttgaaaaaggcatcgttgcagaattaaaccaagcgcttgaatcgatt
aacaccaacgatgcagactcttctgctgaagtacttgagcagttaaaagaaagtaagctt
aagctagcctcgtacgaacataacatggtgcattggcaagttgatgaagagctgattgca
caggttatttctgattggactggtattcctgttggtaaaatgcatgaagatgaaattcat
ggcattttaaatttagctgcgcaaatgaaacaacgcgtagttggccaagatcatgcgctt
gaactcatggctaaagtagtacaaacctctcgtgctcagcttgcagatgaaagtcgccct
aatggtatatttatgctggcaggcccaagcggagtgggtaaaacagagaccgcgctttca
ctagcacaagaagtatatggcagtgaagataacgtaacagttattaatatgtctgagttt
aaagaagagcataaagtgtcattactacttggctcacctccaggttatgttggttatggc
gaaggcggtattttaaccgaagcagtaagaagaaaaccatatagtgtggtgctgctagat
gaaatggaaaaagcccatccaggcgtgcaagatattttctatcaagtattcgataaaggc
accataaaagacggtgaaggccgagatatcgactttaaaaataccatcattattatgacc
tcaaatgtgggtactgataccacaatgagcttatttgaagatgaagaaagtaagccaagt
attaaaggcttattaaaagcattacaagatgatttattaggggcatttaagcctgcattt
ttaggacgaattaacgttattccatatattccgttaagtgatgaaattcttacccagatt
gctgcgttgcaaattagtaaaataattaagcgtgttaaaaagcactatgatgcgcaatta
acgtataacgatgatgtgattgagcacattattgcaaattgtcaaaatgccggatcgggt
gcacgaaatattcacaccatattacagaataaagtactacctctattgtctgagatcttg
ctttcaagcatggttgaaggtgaaaaagtaacatctatctcattgttaattaaagataat
gagttcgatgttgaattaactaaagttaattcaaaataa

DBGET integrated database retrieval system