KEGG   Pseudoalteromonas sp. SM9913: PSM_B0220
Entry
PSM_B0220         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSM_B0220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0220
Secretion system [BR:psm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSM_B0220
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADT70260
Position
II:248348..248827
AA seq 159 aa
MQANTYLKYGSIKGETTAESFKDLITVLSLDWNVSREISAATGTAMDRESSSTRLGDVTI
TKLQDKASPDLFKEATIGKGLPAVFHITKQGDKVEEIMKIELTDAMISSYSVSVQNDRPI
ETITISYTEMMMTVTPTDDQNNITAPLVYGYSGVKGQQM
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcaagcaaatacatatttaaaatacggttcaatcaaaggcgaaactactgctgagtct
ttcaaagatttaattacagttttatctttagattggaacgttagccgtgaaattagcgca
gcgactggtacggcgatggatcgtgaatctagctctactcgtttaggcgatgtgactatt
actaaacttcaagataaagcatctccggatcttttcaaagaagcaactattggtaaaggt
ctacctgctgttttccatatcactaaacaaggtgataaagttgaagaaatcatgaaaatc
gaacttacagatgccatgatctctagctactcagtatcagttcaaaacgaccgtccaatt
gaaacaatcactatcagctacactgaaatgatgatgactgttacacctactgacgaccaa
aacaacatcactgcaccacttgtatatggttacagcggtgttaaaggtcaacaaatgtaa

DBGET integrated database retrieval system