KEGG   Pseudoalteromonas sp. SM9913: PSM_B0221Help
Entry
PSM_B0221         CDS       T01374                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSM_B0221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0221
Secretion system [BR:psm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSM_B0221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 Sarcoglycan_1
Motif
Other DBs
NCBI-ProteinID: ADT70261
Position
II:248901..250754
Genome map
AA seq 617 aa AA seqDB search
MQKATQDKNVIQISTPVGKDALYLTRFVAQEAMSDLFVMSVNMYTIGQQIAHEDLVGKPV
SIKVKNAEGGGERFYHGIVSQLVSNGSRTADVDEQKNYIDYQATIVPFAASMRNRKNSRI
FQKKTIKDIFADLFGQHNVAFSDKTSKTYPKYEYCVQYQESDFDFIQRLLQSEGIFYFFE
HTKSNHTLVLADDITAYEMCGEAKVVHSTGHLSESHVSRWQGGLSLAPGSFKRLGYDFKQ
PSRYPDAEQANAELPTQSVSEIFEYTAEAECHPRAANLASVQLESLQRDMKLSSGRSDCR
SFSVGKLFSFKKHEDPRLEGKTFAITSMMTSIVVPNQSGAAQASSEEVYSNHFECVPKDI
PYRAQVSKKKPVINGVQTAIVTGDSADEIMIDQYGRVKVQFDWDREGKKDSKSSCWIRVA
QNWAGKKWGAFFFPRVGQEVLVDFINGDPDQPIISGAVYNADLMPPYALPGEKTQSGIKT
RSTKEGGADNFNELRFEDKKGSELVYMQAEKDKQLYVKNDQNEKIDNDRNVEILNNDNLK
VTANRVAEMGENDTLKVGKTLNIEAGDEIVIKTGSAQIKMSSSGNITIEGTNIDIKGSNV
KVDGSAITLSAGVIKLN
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagcaacacaagataaaaacgtaattcaaattagtactcctgttggtaaagat
gccctttatttaacacgcttcgttgctcaagaagccatgtcagatttgtttgttatgtcg
gtcaatatgtataccataggccaacaaattgcacatgaagatctggttggcaagcctgtt
tctatcaaggtaaaaaatgccgagggtgggggagagcgtttttatcacggtatcgtgagt
cagcttgtttctaacggaagccgtacggcggatgttgatgagcaaaaaaattacattgat
tatcaagctaccattgtgccttttgccgcttctatgcgtaatcgtaaaaacagtcgcatt
ttccaaaagaaaacaattaaagatatattcgctgatttgtttggccaacacaatgtggct
ttttcagataaaaccagtaaaacctaccccaaatacgaatactgtgtgcaataccaagag
tcagattttgactttatccaacgcttattacaaagtgaggggattttttacttctttgag
catacaaaaagtaatcatacattagttttagcagatgatattacagcatatgaaatgtgt
ggtgaggctaaagttgttcattcaactggccatttaagtgagtctcatgtttcgcgttgg
cagggcggattaagcttagcgccaggtagtttcaaacgtttgggctacgattttaaacag
ccatcacgttaccctgatgcagagcaagcaaacgcagaattaccgacccaatcggtatca
gaaatttttgaatatacagctgaagcagagtgtcatccccgcgcggctaatttggcatca
gttcaactagagtcactgcaaagagacatgaagctctcgagcgggcgcagtgactgccgc
tcattctctgttggtaaactgtttagtttcaaaaaacatgaagacccacgccttgaaggt
aaaacctttgctatcacctcgatgatgacgtcgattgtggtaccaaaccaatcaggcgct
gcacaagcatcgagtgaagaagtgtattctaaccactttgaatgtgtgccaaaagacatt
ccatacagagcgcaagtgagcaaaaagaaaccggttatcaacggcgtacaaacagccata
gtaacgggtgatagcgccgatgaaattatgattgaccaatatggccgcgttaaggtgcaa
tttgattgggatcgtgaaggtaaaaaagactctaaaagttcatgctggatccgagttgca
caaaattgggctggcaaaaagtggggcgcctttttctttccccgcgtaggtcaagaagtt
ctggttgattttattaatggcgacccagatcaacctattataagcggtgctgtttataat
gcagacctaatgcctccgtacgcattacctggtgaaaaaacgcaaagtggtattaagact
cgctcaactaaagaaggtggagcagataactttaatgagctgcgctttgaggataaaaaa
ggcagcgagcttgtgtatatgcaagccgaaaaagataaacagctttacgttaaaaacgat
caaaacgaaaaaatagataacgaccgtaatgttgaaatcctcaataacgataatctcaaa
gtcacagctaaccgtgttgctgaaatgggtgaaaatgacaccttaaaagtcggtaaaaca
cttaatattgaagcgggtgacgaaatagtgataaaaacaggctctgcgcaaattaaaatg
agcagtagtggcaatattactattgaaggtacaaacattgatattaaaggcagtaatgta
aaagtagatggcagtgccattaccttatctgctggtgtaattaagttaaattaa

DBGET integrated database retrieval system