KEGG   Pseudoalteromonas sp. SM9913: PSM_B0222
Entry
PSM_B0222         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70262
Position
II:250757..251113
AA seq 118 aa
MEIVNNFQSGFRNGIANNGHVVYCRYGLPHLVCLPINRPDDPLLSPALSHLKAMNGYYAQ
QFFIHLSDALNSENVISNLYQYATQSAVALSDHSKDELIEEISLLVTSNKLLVIPLYE
NT seq 357 nt   +upstreamnt  +downstreamnt
atggaaatagtcaataactttcaatcaggatttagaaacggcattgcaaataacgggcac
gttgtttactgccgttatggtttaccgcatttagtgtgtttaccgataaacaggccagac
gatccattactaagcccggctttaagtcatttaaaagccatgaatggctattatgcacag
cagttttttattcatttaagtgatgcacttaatagtgaaaatgtaatttcaaacttatat
caatatgcaactcaaagcgctgtggcactttctgatcacagtaaagatgagttaattgaa
gaaatttcgctactggtaaccagtaacaagctattagttatcccgctttatgaatag

DBGET integrated database retrieval system