KEGG   Pseudoalteromonas sp. SM9913: PSM_B0223
Entry
PSM_B0223         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: PAAR_motif DUF4150
Other DBs
NCBI-ProteinID: ADT70263
Position
II:251152..251442
AA seq 96 aa
MGKPAATIGHMHVCPKVTAKVPHVGGPIVAGSGNVLIGGMPAARKGDMIVCVGPPDSVKT
GSGSVQINGKPAARMGDDSGHGGKIVVGNPTVLIGG
NT seq 291 nt   +upstreamnt  +downstreamnt
atgggtaaacccgctgctacaattggtcatatgcatgtatgccctaaagtgaccgctaaa
gttccacatgtgggtggacctatagttgctggctctggcaatgtgttaataggtggcatg
cccgctgcccgcaaaggcgatatgatagtgtgtgttggcccgccagacagcgtaaaaaca
ggctcgggtagtgttcaaattaatggtaaacctgccgccagaatgggcgatgatagtggc
cacggcggaaaaatcgttgtgggcaacccaaccgtgttaattggtggttaa

DBGET integrated database retrieval system