KEGG   Pseudoalteromonas sp. SM9913: PSM_B0224
Entry
PSM_B0224         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70264
Position
II:251445..252470
AA seq 341 aa
MLATYLSDHQAQLLQISNAQLCPFTCVGHVRYLRKTLLESCWLTAKNNNQKNNFELPTTE
QLVEIITNTKNDELVAQACIEVMANLPQNKNIIFINELLNEPALSAFFKIIINKVVIQQH
SFNLIRLLNLNTLFFAYSAEEEIAPQTLVTINQITSLAQHHDRQILTAIFDALSEQAHLS
PLMSLFLLSLNFEQVNSLSNHASNTLSVDHTLHILLQSGFVKLIVLANSLLQQVEQPALI
IALIRRMLGDKLDQLVEYDIQRLAWQGDESALIDFQQQLKHNWPKYETAMSSLRLIAGHP
LDEVPNAIYLSAMDSYSQGVFNLYRYYQHLAANKTQDEVAP
NT seq 1026 nt   +upstreamnt  +downstreamnt
ttgctagcgacctatttaagtgatcatcaagcacaattactacaaattagtaacgctcaa
ctgtgcccgtttacgtgtgtaggtcatgttcgctatttaagaaaaacgctattagaaagc
tgttggttaacggcaaaaaacaataatcaaaaaaataactttgaattgcccaccactgag
caactagtcgaaataataactaacaccaaaaacgatgaattagttgcccaagcatgtatt
gaagttatggctaacttgccacaaaataaaaatattatatttataaatgaattacttaat
gagccagcgctgagtgctttttttaaaatcattataaataaagtcgttatccaacagcat
agctttaacttaattcggctactaaatttaaacaccttgttttttgcttacagtgctgag
gaagagattgccccgcaaacactggtcactataaatcaaattaccagccttgcgcagcac
cacgatagacagatattaacggctatttttgatgcattaagtgagcaagcccatctatca
cccttaatgtcgttatttttgttgtcgttaaattttgagcaagtaaacagcttaagtaat
catgccagtaataccttatcggttgatcacacattgcatattttattacaaagcggtttt
gtaaaactaattgttttggctaattctttattacaacaggtagagcaacccgcgttaatt
attgcgctaataagacgcatgttaggtgataaactcgatcagctagtggagtacgatatc
cagcgactcgcttggcaaggtgatgaaagcgcgctaatagattttcagcagcagttaaaa
cataactggcctaaatatgaaaccgccatgtcgagtttacgactgattgcagggcaccct
cttgatgaagtgcctaatgccatttatttatcggccatggatagctatagccaaggggtg
tttaatttatatcgctattatcaacatctcgctgccaataaaactcaggacgaggtggca
ccatga

DBGET integrated database retrieval system