KEGG   Pseudoalteromonas sp. SM9913: PSM_B0225
Entry
PSM_B0225         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70265
Position
II:252467..253312
AA seq 281 aa
MSAFSIEMTCFSVPNISSVDTLLFDDNSAVFNELQWQSWDACVYDCIIKSKELMAEVTDS
TLPMIWLLPALSFQDELKQLLAQSLQQLYPDHSNELIFHGTTGAHSAIALAGEKKWQKFN
VIALDATFKANKQQQFVYQGVGGALAVVEMVPCGWSQVSHEIAASIDFSKHNQLAGMLTR
LAEQTENKIDLIFAPGNGVDDDSWLNNLQLLTSLIDEHTYYELPNYKLGKIGALEGLVNL
YQLTTSPAIVEHFSYALMLSQEQAKHQGAASYLWISEEVDS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgagtgcattttcaatcgagatgacatgcttttctgtcccaaatattagcagcgtagac
acattattatttgacgataacagtgctgtttttaatgagttgcaatggcagtcttgggat
gcatgtgtttacgattgcataattaaatctaaagaattaatggcagaagtcacagacagc
acattgccgatgatttggttactaccggcattatcatttcaagatgagctaaaacagtta
ttagctcaaagcttacaacagttataccccgatcatagcaacgagctgatttttcatgga
acaacaggtgcacactctgctatagctttggctggtgaaaaaaaatggcaaaaatttaat
gtaattgctttagatgcaacttttaaagcaaataaacagcaacagtttgtatatcaaggt
gtaggtggtgcgttggctgtagttgaaatggtgccttgcgggtggtcgcaggtaagccat
gagattgcagcatctattgattttagcaaacataatcagctagcaggtatgcttacgcga
ttagctgaacaaacagagaataagattgatctaatttttgcaccgggaaatggggtagat
gatgatagttggctaaacaatttacagctacttactagcttaattgatgagcacacatat
tacgaactacccaattataaattagggaaaataggcgcactagaagggttagttaatttg
taccaattaaccacaagccctgcaattgttgagcattttagttatgcattaatgctctcc
caagagcaagctaagcatcaaggtgcagcatcatacttatggataagtgaggaagtagac
agctaa

DBGET integrated database retrieval system