KEGG   Pseudoalteromonas sp. SM9913: PSM_B0226
Entry
PSM_B0226         CDS       T01374                                 

Definition
(GenBank) YD repeat-containing protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: RHS_repeat WHH Colicin-DNase RHS PPL5
Other DBs
NCBI-ProteinID: ADT70266
Position
II:253312..258009
AA seq 1565 aa
MQSNTVVLQGISYPICLVAGKGSAPSGFVAVAANTPESAKNQIAQIGSALTSDAAKRLDV
INLLNLAGVSCSRGASARETASVLTQALVADKISCYHQKAKSAIQVSDNTNSGAAGKKPS
SKSSSTASGKSASQAPAKNSGGASNNTPSEEPITKQECRSDPVSMLSGEEILPLIDFTLA
GSKQLIWRRLYRSSHADVCSVMGNGWRHDFMVQLTEHYLPPPKVGPKQKGTYWLEYQDEH
GAKHRFEKVKPGQSSYQLSSNLALHYQTNGKQVLVTPDDQHLTFKAGENSWLLEKVINEK
GQSIGFYYDAKERLHRVEVNKARGCILKYNPQGLLANISAYRTGDNNKPVLLTPLLAQYD
YDENKNLVRATNQQGETEHYGYNAANLLTKRTRASGFSHHFEWDSYSSSAKCIKQWGDNN
TYTYQFEYNLDAGETTCIDSRGHKEHFVHNAQGKLVKHTDPNGNVWHYRYNAQGQKITEI
KPDSSEIKYSYTPYGQLESITQPDGSVTKFAYNQLGQRVLTTLPDGQTITRKYSVAGLLQ
SETFGDGRTVLYSYDKFGQLTQHINKDGQVTKFVWNEQGELLAKHHNDELIRYSYDSLGR
VNATINNAGLLTQYKYNEHGQLAQTIAFDEKDPENKQHQHFSYDDAGRLISSQNSKGDTT
EQHFEGLSQPHCVIQPDGSALHLTYDKERNLTAIERSDGHVYRISYDANENPTQVTGFDG
TLQQYKYDACNRLTSVTQSDKRHVKIERDKLGRVIAQHASLATDTHIVNNANYYSYNLQG
KITRAHNAQSTLKQQFDKGGRLVRAEQVHNQQQAHTLKYSYDDYGRRQSLTLPDSSKLNY
SYNKFGQLSGIHLQQANSTAVELAALSYDSQGNIQTQKFGNDITLTQQFDVFNRLTQQQL
THPAQALFDTCTYIYDSVNQLIARKEEGVSSHNINFEYNSLGQLIQQNLVSSENTKTTQY
QWDSFGNPVSQSTVKNDELAEQQTPQHNDDSDASNKVESNQSESTPNVINSEYNDSNAAT
FASDLSDNDDVITGTTDADRLTHFGDSDFHYDEFGNQIRETGKGIKTRREYNAFNQLSCF
NNNGTLTQYDYDPLGRRIAKHTEQGKIDYIWDNDQLIGEYQQGEYTWYINLPNQFHPVAL
IKKGEVYYYHLDQLNTPRFVTNNKTEVVWENQADVYGYEESEANTTNSFTQPIRFQGQYL
DIESGLHYNRYRYYSPKQQRFINQDPIGLVGGINHYQYAPNPVNWVDPFGLSCKEGDAKR
VVFAGHGIIDETKSAIVPVGSTLTVYAFNGATITDDLGQLIESGGSLNSNVYKKVYVAGD
VIPGYVLLDNPGDIELLDSSVQVSKPTDISELLAENVGDCHWAACASIFGHENENVIHHT
EGIFKKESNKFYQLQDDDSWSELLEDNASEDTRSITKPYGIEQSALEKALINDINPDKVI
NGRKIINSDLAGTIVKTKGGDVAFDTDGFPDFTPYSQKTVSVEGLTGDMLNDVPLAMEKA
GIEVYDKTKYVWHHHQDAKTMMLIPKSVHSVRNGGVAHTGGRAVIKHNKDNPNNVLNYKS
PKELV
NT seq 4698 nt   +upstreamnt  +downstreamnt
atgcaaagtaataccgttgttttacaaggaataagttacccaatttgcctcgtcgctggt
aaaggttctgcgccgtcgggctttgttgctgtagcagctaacacgcctgaaagtgccaaa
aatcaaattgcgcaaataggcagtgcgcttactagcgacgccgctaaacgtttagacgtt
attaacttgcttaaccttgcaggagtgagctgttcgcgcggtgcgtcagcccgtgaaacc
gcgagtgtattaacccaagctttggttgcagataaaattagttgttatcaccaaaaagct
aagtcggctattcaagtaagcgataacactaatagcggcgcagcaggtaaaaagccaagt
agtaagagcagttcaacagcctcaggtaaaagtgcctctcaagcgccggctaaaaacagt
ggcggtgcaagtaataataccccaagtgaagaacctatcaccaaacaagagtgccgctct
gatccagtttctatgctctcgggtgaagaaatactgccgcttattgatttcaccttagca
ggtagcaaacaattaatttggcgacgcctataccgttcatcgcatgcggatgtatgcagt
gtaatgggtaatggttggcgacatgactttatggtgcagttaactgagcattacttaccg
ccacctaaagtaggcccaaaacaaaaaggcacctactggttagaataccaagatgagcat
ggcgctaaacaccgctttgaaaaagtaaaaccggggcaatcgagctatcagctaagcagt
aatttggcgttgcattaccaaactaatggtaagcaagtattggtaacgccagatgatcag
catcttacgtttaaagctggcgaaaactcatggttgctcgaaaaagttattaatgaaaaa
ggccaaagtattggtttttattacgatgcgaaagagcgcttgcatcgcgttgaggttaat
aaagcacgcggctgtattttaaaatataacccgcaagggttgctggcaaacatttcggct
tatcgtacaggtgataacaacaagccagtattactaacgccgttacttgcgcaatatgat
tatgatgaaaacaaaaatctcgttcgcgcgaccaatcaacaaggtgaaacagagcattat
ggctataacgccgctaatttattaactaagcgtacccgtgccagtggttttagccatcac
tttgaatgggatagttactcatcaagtgctaagtgtataaaacaatggggcgataacaac
acctatacgtatcagtttgaatataatttagacgctggtgaaacaacctgtatagactcg
cgtgggcataaagaacactttgtacataacgcgcaaggtaagttagttaagcacaccgat
cctaatggtaatgtttggcactaccgctataacgcacaaggccaaaaaataacggaaata
aagccagacagcagtgaaataaaatacagttataccccttacggtcagttagaatcaata
acgcagccagatggcagtgtcactaaatttgcttacaaccaattgggtcagcgtgtatta
accaccttgcctgatggtcaaacaataacccgtaaatacagtgtggcgggtttgctgcaa
agtgaaacctttggcgacggtcgcaccgtactttacagctatgacaaatttggccagcta
acccaacacataaataaagatggtcaagtcactaaatttgtatggaacgagcaaggcgag
cttttagccaaacaccataacgatgagctcattcgctacagctacgacagtttaggccgt
gtaaatgccaccattaataacgcaggtttgctgactcaatataaatacaatgagcacggc
cagcttgcgcaaactattgcctttgacgaaaaagaccctgaaaataaacagcatcaacat
tttagttacgatgatgcagggcggttaattagctcgcaaaacagtaagggtgataccacc
gagcaacactttgaagggctaagccagccacattgtgttattcagcccgatggcagtgca
ttgcatttaacttacgataaagagcgcaacctaaccgctatcgaacgtagcgacggccat
gtataccgcataagttatgacgctaacgaaaacccaacgcaagtaactggatttgatggc
acgctacagcaatataaatacgatgcttgcaaccgcttaacctcggttacacaaagcgat
aaacgccatgtaaaaatagagcgtgataaattaggccgcgtgattgcgcagcatgccagt
ttggcaaccgatactcacatcgttaataacgccaattactacagctataacctgcaaggt
aaaattactcgtgcgcacaatgcacaatcaaccttaaagcagcagtttgataaaggcggg
cgattagtacgtgctgagcaagtacataatcagcaacaagcccataccttaaaatacagt
tacgacgactacggcagaaggcaatcactgaccttgccagattcaagcaaactgaattac
agttataataaatttggtcaattgagtggcattcacttacagcaagccaatagcacggct
gttgaacttgcagcgcttagctatgacagtcaaggtaatattcaaacgcaaaagtttggt
aatgacataacccttacccaacaatttgatgtatttaaccgcctaacacaacagcagtta
acccatcctgcgcaagcactatttgatacctgtacgtacatctacgacagcgtaaaccag
ctgattgcgcgtaaagaggaaggtgttagtagtcataatattaattttgagtacaacagc
ctaggccagttaattcaacaaaatctagtaagttctgagaacacaaaaaccacgcaatac
cagtgggatagctttggtaacccagttagccagtcaacggttaaaaatgacgaattagct
gagcagcaaactcctcagcacaatgatgatagcgacgccagcaataaggttgaaagtaac
cagtcagaaagcacacctaatgtaattaatagcgaatataacgattcaaatgcagcaacg
tttgctagtgatttaagtgataatgatgatgttattacaggtaccactgatgccgaccgg
ttaactcactttggcgacagcgactttcattatgatgaatttggtaaccaaatacgcgaa
accggcaaaggtataaaaacccgccgcgaatacaatgcatttaatcagctaagttgcttt
aacaacaacggtacgcttactcaatacgattacgacccactcgggcgtcgtatcgccaaa
cacaccgagcagggcaaaattgactacatttgggataacgaccagctaattggcgaatac
caacagggtgaatatacctggtatatcaacctgccaaatcaatttcacccagtcgcgctg
attaaaaaaggtgaggtgtactactaccacctagaccaactgaatactccacgttttgta
accaacaacaaaacagaagtagtctgggaaaaccaagcagatgtatatggttatgaagag
tcagaggcaaacactacaaatagcttcactcagccaatacgttttcaagggcaatattta
gatatcgagagtggcttacattacaaccgctaccgctactacagccccaaacaacaacgc
tttataaaccaagatccgattggccttgtgggtggcataaaccactatcaatatgcgccg
aatccagttaattgggtggacccgtttgggttgagttgtaaggaaggagatgctaaaagg
gttgtttttgctggccatgggattatagatgagactaaatctgcaatagtccctgtggga
agtactctaacggtatatgcatttaatggagcgacaataacagatgaccttgggcaatta
atagaaagtggcgggtccttaaatagtaatgtatataaaaaggtatatgttgctggtgat
gttatccccgggtatgtgttacttgataaccctggagatatcgagcttctcgatagttca
gttcaagtttctaaaccaacagatatatcagaacttctagccgaaaatgtaggggattgc
cattgggctgcatgtgcttcaatctttgggcatgaaaacgagaatgtgattcaccatact
gagggcattttcaaaaaagaatcaaataaattttatcagctacaagatgacgatagttgg
agtgagttgcttgaagataatgctagtgaagatactcgaagtataactaagccatatggc
atagaacagtcagctttggaaaaagctttaattaatgatatcaatcctgacaaggtaatt
aacggtcgaaaaataattaactcggatctagcaggtactattgttaaaactaaaggcggg
gatgttgcgttcgataccgatggtttccctgattttactccatactcacaaaaaacagtc
tccgtagagggcttgactggggatatgctaaatgatgtacccttagcaatggaaaaagct
ggtattgaagtatacgataaaactaaatatgtttggcatcatcaccaagatgctaaaaca
atgatgctcattcctaaatctgtgcactctgttagaaatggaggtgttgcacatactgga
ggcagggcagtgataaaacataacaaagataatcctaataacgtattgaattataagtct
ccaaaagagcttgtataa

DBGET integrated database retrieval system