KEGG   Pseudoalteromonas sp. SM9913: PSM_B0227
Entry
PSM_B0227         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: SUKH_6
Other DBs
NCBI-ProteinID: ADT70267
Position
II:258020..258397
AA seq 125 aa
MTEIKSIKHIIKRVWREPECTLLLSSQVDTTLYSELSKEIPDKYLVIEEVFCDEELDDIW
ESFKGYLSEYEVFPFLGLFGGAVICVGYGENNIGKIFYFDFDFGCLQFDRDDLNQFISKL
KCVDA
NT seq 378 nt   +upstreamnt  +downstreamnt
atgactgaaattaagagcattaaacatataattaaaagagtatggcgagagccagaatgt
accttactgttatcttcacaagttgacaccacactgtatagtgaacttagtaaagaaatc
ccagataaatatttagttatagaagaagttttttgtgatgaagagctagatgatatatgg
gaaagctttaaaggatatttaagtgaatacgaggtttttccttttctaggtttatttggt
ggggccgttatatgtgtaggttatggagagaataacattggcaaaatattttattttgac
ttcgactttggttgtttgcagtttgaccgtgatgatttgaatcaatttattagtaaattg
aagtgtgttgatgcttag

DBGET integrated database retrieval system