KEGG   Pseudoalteromonas sp. SM9913: PSM_B0228
Entry
PSM_B0228         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70268
Position
II:258838..259140
AA seq 100 aa
MACINIKNLTLQDVASFTLKNNPSKQFKEKWGDEYFSRAMSLWRGVKECYSKSKECNFTT
QELLFAMNYEYAVAPYSSENNNAIEFYRWCFENLNKIKDR
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcatgtataaatatcaaaaatttaacacttcaagacgtcgcttcatttacgctaaaa
aataaccccagcaagcaatttaaagaaaaatggggtgacgagtattttagccgcgcaatg
tcattatggcgtggagtaaaggaatgttattcaaaaagtaaagaatgtaacttcactaca
caagagcttttatttgcaatgaactatgaatatgcagttgctccttacagctctgagaat
aataacgctattgaattttatagatggtgttttgaaaatttaaataaaatcaaggataga
taa

DBGET integrated database retrieval system