KEGG   Pseudoalteromonas sp. SM9913: PSM_B0229
Entry
PSM_B0229         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Cofac_haem_bdg ILEI CPT
Other DBs
NCBI-ProteinID: ADT70269
Position
II:259140..259913
AA seq 257 aa
MNKINTDVNYRTMAGNARLVMLGESSHSAAGYKYEAIKAIRQLKAAGFTHFAIEMLPSSM
QEKIELYQRTGKGFNIIQQYFDKYWTHGDFTPQAYGELVKAARNAGMKIVALDVSVETME
VMDSVCPSTKAVTGECFDAHTFRNDLWAYNLATILKRAKQNKIVAFMSRWHAVKNLKYQI
GIDSLIKEHGIQNVRFIDFIGGLSCYSDRPCKGMSSQQETLKGQYFYKEGFPYESTVKSF
QVHLPEKRINNDGSFQW
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaataaaataaacacggatgtaaattacagaacaatggccggtaatgcgcgtttagtt
atgttaggcgaatcgagccatagtgctgctggctataaatatgaggctataaaagcgatt
aggcagttaaaggctgcgggttttacacattttgctatagaaatgctgcctagctcgatg
caggaaaaaattgaactgtatcaacgaacaggtaaaggctttaacataatacagcaatat
tttgataaatattggacacatggtgattttactcctcaagcctatggtgagctggtaaag
gcggcacgcaatgcaggaatgaagatagttgcattggatgtttctgtagaaacgatggaa
gtaatggatagtgtatgcccatcgacaaaagccgtgactggagagtgttttgacgcgcat
acgtttagaaacgatctttgggcttataatttagctacaatcctcaagagagctaagcag
aataaaattgttgcttttatgagtcgatggcacgcagttaagaatttaaagtatcaaata
ggtattgattctttaattaaagagcacggtattcaaaatgttcgttttattgattttatt
ggtggcttatcttgttacagcgacaggccgtgtaagggcatgtctagccaacaagagact
ttgaaaggacaatacttctacaaagagggttttccgtatgaaagtacggttaaatcattt
caagtccacctaccagaaaagcgtattaataatgatgggtcattccaatggtaa

DBGET integrated database retrieval system