KEGG   Pseudoalteromonas sp. SM9913: PSM_B0230
Entry
PSM_B0230         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: TPR_7 Sel1 TPR_1 TPR_2
Other DBs
NCBI-ProteinID: ADT70270
Position
II:259907..260494
AA seq 195 aa
MVKAPVTLVLAIVFFIFTDAKASMFANIDINDPNLTVEIAAKQCEKSYMHAPNKLEEWCE
KAYEMGHLESLYYIGMYTGNGSRYLNELNIRIEQGEANAINTLAWLYQSGRLVKKDLSKA
ARLYQLYLAQENNQAITLKTSTHFELATIYRKLGMWDKVITHTQYVIDKAKREGRRELAQ
RWRDEAETYLKESNL
NT seq 588 nt   +upstreamnt  +downstreamnt
atggtaaaagcaccagtgacacttgtgttagcaattgttttttttatttttacggatgct
aaagcatctatgtttgcgaatattgatattaatgatccgaacttaaccgttgaaattgca
gctaagcaatgcgaaaaaagctatatgcacgcacctaacaaattagaagaatggtgtgaa
aaagcttacgaaatgggtcacttggagtccttgtattatattggtatgtatactgggaat
gggtcccgttatttaaatgaattaaatattcgaattgaacaaggtgaagctaatgctatt
aatacattagcttggttataccaaagcggccgtttagttaaaaaagatttaagtaaagct
gcacgcttataccagctttatttagcacaagaaaataaccaagcaattacacttaaaact
tctacacattttgagttagctacaatttatagaaagctgggtatgtgggataaagtaata
actcatactcaatatgtaattgataaggcaaaaagagaaggtcgtagggaacttgcacag
agatggcgagatgaggctgaaacatatttgaaagaaagtaatttgtga

DBGET integrated database retrieval system