KEGG   Pseudoalteromonas sp. SM9913: PSM_B0231
Entry
PSM_B0231         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70271
Position
II:260491..261108
AA seq 205 aa
MSFSRVYSFSLGSHVTKYLLISALFTFSLISNAAGPRWDNSIDINAPDLTVLAAAEQCHK
SLINAPEYLEEWCEKAYGMGYWKALVTLSLHNGDGTRLLEEAKKRVAAKEPKAYSTLAWL
YGSGMFVEQDINYAIALYKEFLALDAELPNSLVAAAHFKLANLYESQQDWLAVNEHAQYV
IDHSPLAYDKERAVDLIKLAKKIFD
NT seq 618 nt   +upstreamnt  +downstreamnt
gtgagtttttcacgcgtatatagcttttcacttggcagtcatgtgacaaagtatttatta
attagtgcactgtttacttttagcttaattagtaatgccgctggccctcgatgggataat
tcaatagatataaatgctccagatttgactgtattagctgccgcagagcagtgccataaa
agtttaattaacgcgcctgagtatcttgaagagtggtgtgaaaaagcttatggaatggga
tactggaaggcactggttacactaagcctccataatggagatggaactcgattattagag
gaggccaaaaagcgggttgcggcaaaagagccaaaagcttattcaactttagcttggtta
tatggcagtggtatgtttgtggagcaagatattaattatgctattgccctttacaaagaa
tttttagcattagatgcagaattaccaaattcgttagttgcggctgcgcactttaagtta
gcaaacttatatgaatcgcagcaggattggcttgcagtaaatgagcatgcacaatatgtt
attgaccacagtcctttagcttatgataaagaacgagctgttgatttgataaagttagct
aaaaaaatttttgattaa

DBGET integrated database retrieval system