KEGG   Pseudoalteromonas sp. SM9913: PSM_B0233
Entry
PSM_B0233         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70273
Position
II:261508..262293
AA seq 261 aa
MTLINTCILMLFLQPLFVYLALFKQSKYSVEPKSSLDNEDSMFLFIAPGLSVFYLDQFWV
ALLYLGSVCLLGVLLAKIVESKANKRLTRDDSIGFMVASFIFFGMIKLIIVAVAYFFTDD
ASSAITEDLSPAKEPSLTISQMFSVDYLYSQFKPTVYFLALMVVTLVLKIIEYKFSLKEA
LSGILIMLSALLVGISPLFGEAYILGLIANFFIFFIVCSTCIEIDKIGDASGGAIAILYG
YILMMGLGFSIICKLVYEVFF
NT seq 786 nt   +upstreamnt  +downstreamnt
atgactcttataaacacctgcattttaatgctgtttttacagccattatttgtttattta
gcactttttaaacagtcaaaatacagcgttgagcctaaaagttcgttagataatgaagat
tcaatgtttttatttattgcccctggcttatcggttttttatcttgatcagttttgggtc
gcgctgctttatttaggtagtgtgtgcttattgggtgtattgctagctaaaattgtagaa
agtaaagcaaacaagcgattaaccagagacgattcaatagggtttatggtcgccagtttt
atcttttttggaatgataaagttaattattgttgcggtagcgtatttttttaccgatgac
gcttcaagcgcgataacagaagatttaagcccagctaaagagccctcattaacgattagc
caaatgtttagtgtggattatttatatagccagtttaaacctacggtttattttttagca
ttaatggtcgtgaccttggtgctcaaaattattgagtataagttttctctgaaggaggcg
ctttcaggcatacttattatgctaagtgcgttattagtcggtatttccccattatttggc
gaagcttatatattaggcttaattgctaacttttttatcttttttatagtgtgctctaca
tgtattgaaatagacaaaataggggatgcatcgggtggcgctattgctattttgtatggc
tatatattaatgatgggactagggtttagcattatatgtaagctggtttatgaagtgttt
ttttag

DBGET integrated database retrieval system