KEGG   Pseudoalteromonas sp. SM9913: PSM_B0234
Entry
PSM_B0234         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: DUF4198 Big_1 CarboxypepD_reg TTR-52 DUF1416 bMG3
Other DBs
NCBI-ProteinID: ADT70274
Position
II:262471..262983
AA seq 170 aa
MLSRFKAYFLVVVSITIIFTTTQACADMFGFFNKQDFVLSAPMKGQLLDKGQPVANTKVV
RALTYGDEYKDEAITDENGFFTFTEKSIKTSKPANMFDNESLVQHVYLENGTPEGVVLWY
TTVSMHEGSDTLKNLLANLECDIAEEPQTYDIPIEEAPEHFFTIYGACKM
NT seq 513 nt   +upstreamnt  +downstreamnt
ttgttatcgcgttttaaagcttactttttggtagttgtatctattactattatttttact
acaacacaggcttgtgcagatatgtttggtttttttaataagcaggattttgttttatcg
gctccgatgaaggggcagttgttagataaagggcagcctgttgcaaatactaaggttgta
cgtgcgcttacttatggtgatgaatataaagatgaagcaataaccgatgaaaatggtttt
tttaccttcacagaaaaatctataaaaacgagtaagcctgcaaacatgtttgataatgaa
tcactggttcagcatgtttatttagaaaatggtacgcctgagggcgttgtactttggtac
acaaccgtgtctatgcacgaagggagtgataccctaaaaaacttactcgctaacttagag
tgtgatattgccgaagagccacaaacatacgacatacctatagaagaagcaccagagcat
ttctttacgatatatggtgcatgtaaaatgtaa

DBGET integrated database retrieval system