KEGG   Pseudoalteromonas sp. SM9913: PSM_B0235
Entry
PSM_B0235         CDS       T01374                                 

Definition
(GenBank) predicted lipase
  KO
K01046  triacylglycerol lipase [EC:3.1.1.3]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00561  Glycerolipid metabolism
psm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PSM_B0235
Enzymes [BR:psm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     PSM_B0235
SSDB
Motif
Pfam: Lipase_3 Abhydrolase_6 DUF2974
Other DBs
NCBI-ProteinID: ADT70275
Position
II:263014..264180
AA seq 388 aa
MNTLTPTQAVQVALLAYKAKSIKSTTLLNNSLHPSLRGSFNFGVSPEAVQGISGGFFSHL
FGLSTGFGLLGHGQGLYQGDSVITIRGTASLRDGLTDAHFGLSGGSNGSMVHAGFNKTFY
SMKPALQEFVAANIRDKITGCVHIVGHSLGGALATLSADWIKAEYSLPVKLYTFGSPRVG
LDNFSRAATSRIDKIYRCTHGADPVTKVPLWPFSHAPYNGQEIRLDNGQGLKGAAHKLSG
TPGYVNTANSNDWGNLTVKANHFLSTPVRLKFEDRNQASFSSHWADKLGAALVTLLKDSG
YYSAVAAQAAIGTGLTFYDMLARTLDKIAKASASFATQTLGLLGHMLVFAGKVISKAVEL
TYSFIKSVFDSTLGALYRAAREGLNGLD
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaatactttaactcctacacaagctgtacaagttgctttgcttgcttataaagcaaag
agtattaaaagtaccacgttacttaataattctttgcatccttctctgcgaggtagcttt
aactttggggttagccctgaagcagtacaaggaatatctggtggttttttctctcattta
tttggtttaagcactggttttggtttgctaggacatggccaagggctgtatcaaggtgat
tcagtaatcactattcgcggcacggcctctcttagagatggcctaacagatgcacacttt
gggttaagcggtggctctaatggcagtatggtacatgctgggtttaataaaaccttttat
agcatgaagcccgctttacaagagtttgtagcggctaacattcgagacaaaataaccggc
tgtgtgcacattgttggtcacagtttaggtggtgcattggctacgctttcagccgattgg
ataaaagcagagtattcgttacccgttaaattatatacatttggctcgccaagagtaggg
cttgataacttttcgcgcgctgctacttctcgtattgataaaatataccgctgtacacac
ggtgctgatccggttacaaaagtgcctttgtggccattttcacatgcgccctacaatggc
caagaaattcgtcttgataacggtcaaggtcttaaaggcgcagcccacaagttaagtggt
acgccaggctatgttaataccgcaaacagtaatgactggggcaatttaactgtaaaagca
aaccacttcttaagcacaccggtacgtttaaagtttgaagacagaaaccaagcttcattt
agttcacactgggcagataaactgggcgctgcgttagttaccttattaaaagattcgggt
tactacagtgctgttgcggcacaagcagccataggtacaggcttaactttttacgatatg
ctcgcgcgaacgcttgataaaatagccaaagcgtcagcctcatttgcaacgcaaacctta
ggtttactcggccacatgctagtgtttgctggcaaagttattagtaaagccgtagagctg
acttacagttttattaaatcagtatttgattcaactctaggggcattatatcgtgctgca
cgagaaggcttaaatggtctagattaa

DBGET integrated database retrieval system