KEGG   Pseudoalteromonas sp. SM9913: PSM_B0237
Entry
PSM_B0237         CDS       T01374                                 

Definition
(GenBank) FMN reductase, NADPH-dependent
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: FMN_red Flavodoxin_2
Other DBs
NCBI-ProteinID: ADT70277
Position
II:264751..265215
AA seq 154 aa
MQEESAHHIAIIYSSGRKNGNTTAQVNAYSKQQSGIVFCLDDYVISPYRYDKQYHNDDFY
NLFEVLLRYEHWVFSSPVYWYNTTPQMKAFMDRITDYMDDEALKPKLRTLRQKQFSLLSN
AASPSAPDAFIDMFKHTFNYLGMTFKSHSHIQAS
NT seq 465 nt   +upstreamnt  +downstreamnt
atgcaagaagaatcagcacaccatatcgcaatcatatattcaagtggtcgtaaaaatggc
aacactaccgcgcaagttaatgcctatagtaagcaacaaagcggcattgttttttgctta
gatgattatgttatttcaccttatcgctacgataagcagtatcacaatgatgatttttat
aatttgtttgaagtgttacttcgctacgaacattgggtgttctcatctcctgtgtactgg
tataacaccacgccacaaatgaaagcatttatggacaggatcacagattacatggatgat
gaggcgttaaaaccgaagcttagaactttacgtcaaaagcagttttcactgctgtctaat
gccgcatctccctctgcgccagacgcatttatcgatatgtttaaacatacctttaattat
ttaggaatgacttttaaatcgcattcacatattcaggctagttaa

DBGET integrated database retrieval system