KEGG   Pseudoalteromonas sp. SM9913: PSM_B0238
Entry
PSM_B0238         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: DrsE NAD_binding_1 Fcf2
Other DBs
NCBI-ProteinID: ADT70278
Position
II:265263..265787
AA seq 174 aa
MKTLLIGSSLLLASFSTLAAEPAPVIKDYGYFYNVPENVSDLSQAQFKIAFDVGKGAEKG
AQNNHINSLARFINMHVAHGVKPENIQLALVVHGGASVDVLQNSDYKARFEKDNKTESLI
KQLLANNTQVYVCGQSAMHMKVAADQLIPGVKMALSAMTAHAQLQQQGYTLNPF
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaaaacgttacttattggctcaagcttacttttggctagctttagtactcttgctgca
gagcctgcgcctgttattaaagactatggttatttttataatgtgcccgagaatgtgtct
gatttaagccaagcgcagtttaagatagcttttgatgtaggtaaaggcgctgaaaagggc
gcgcaaaataatcatattaattcgttagcgcgatttattaatatgcatgtggctcacggc
gtaaaaccagaaaatattcagcttgcgctggtggtacacggtggagccagcgttgatgta
ctgcaaaacagtgattataaagctcggtttgaaaaagataacaaaaccgaatctttaatt
aaacagctgcttgctaataacacgcaggtatatgtatgcgggcagtcggcaatgcatatg
aaggtagcagcagatcagcttatacctggggtgaaaatggcgctttctgcgatgactgcg
catgcgcagttacagcaacaaggctatacattgaatccgttttaa

DBGET integrated database retrieval system