KEGG   Pseudoalteromonas sp. SM9913: PSM_B0239
Entry
PSM_B0239         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL
Other DBs
NCBI-ProteinID: ADT70279
Position
II:265787..266404
AA seq 205 aa
MNILCFGDSNTFGISPVDGKRLSEIERWPTLLKQQLGTGFEVIEAGEPNRTLVNNPPFMG
DKSGIKYLKPYLEAHTVDVVIIQLGTNDLKARFALFAIDIGKALEELILAIKAFYHCKTI
SKIIIISPPKVREVGSYKSIYAGAGKKAEQLSIEFKAASDRHTCEFLDCYPLIKPCKKEG
IHLPVSAHRELANRLTPIIKKAAVY
NT seq 618 nt   +upstreamnt  +downstreamnt
atgaatattctgtgttttggtgattccaatacctttggtatttctcctgttgatggcaaa
cggctgagcgaaattgaacgctggcctactttattaaagcagcagttgggcaccggcttt
gaagtgattgaagccggggagcctaatcgtactttagtcaataaccccccgtttatggga
gataaatcgggcattaaatatttaaaaccgtatctggaagcgcacactgttgatgttgtt
attattcagcttggcaccaatgacttaaaagcacgttttgcactgtttgctatcgatatt
ggcaaagcgcttgaggagttaattttagccattaaagccttttatcattgtaaaacaata
tcaaagataatcattataagcccgcccaaggttcgtgaagtgggaagttataaaagcatt
tacgcaggtgcaggtaaaaaagctgaacaattatccattgagttcaaagccgcctctgat
cgtcacacgtgtgaatttttagattgttatccgctgataaaaccatgcaagaaagagggc
atacacttacccgttagtgcgcatagagagcttgctaataggttgacacctataataaaa
aaagccgccgtgtactaa

DBGET integrated database retrieval system