KEGG   Pseudoalteromonas sp. SM9913: PSM_B0242
Entry
PSM_B0242         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K08174  MFS transporter, FHS family, glucose/mannose:H+ symporter
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0242
Transporters [BR:psm02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    PSM_B0242
SSDB
Motif
Pfam: MFS_1 Bax1-I
Other DBs
NCBI-ProteinID: ADT70282
Position
II:270147..271385
AA seq 412 aa
MSKIKITLAIAASYFIFAILLNSVGTVILQAINTLGVSKTEASVLEGFKDLSIAIMSFVV
ASFIPRLGYKLAMLLALIVVAIACLSTAVISDFYMFKVLFAAVGCGFAVVKVSVYSIIGQ
VTEDANSHSSLLNTIEGIFMVGVLSGYWVFTAFIDPVDSNAWLNVYYVLAALTLLVIISV
VIAPIKPAIKGQKSNSGWSDFIAMLKLTYQPLVLIFIISAFLYVLIEQGVGTWLPTFNNQ
VLQLPVAISIQLASIFAAALALGRLVAGQVLKHIHWFVVLSCCLVAMAALIIITLPLTEN
LPKSEVNSLFDAPLAAFVLPLIGFFMAPIYPVLNSVMLSALQKHQHAAMTGLIVVFSALG
GTTGSVITGYVFEHFSGQHAFYLSLVPISLIFISVIIFKKRTHAISQHAVNS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagtaaaataaaaatcacactggcaattgctgcaagctattttattttcgcaatttta
ttaaatagcgtaggcactgttattttgcaggctataaacacattaggggtaagcaaaaca
gaagcgtcggttttagaggggtttaaagacttatcaattgcaataatgtcatttgttgtt
gcttcatttataccacgtttaggctacaagcttgcaatgctgctagcactgatagttgtc
gctatagcgtgtttgagtacggctgtaataagtgacttttacatgtttaaagtgttattt
gctgctgtgggttgtggttttgcggtcgttaaggtgtcggtttattcaattattggccaa
gtgactgaggatgcaaatagtcactcatcattactgaacaccatagaaggcatttttatg
gtgggtgtattaagtggctattgggtattcaccgcatttatagaccctgttgatagcaat
gcctggttgaacgtttattacgtattagcagcgcttacgcttttggtgattatcagtgtc
gtaatagcaccaataaagcctgctatcaaaggtcaaaaaagcaactcgggttggagtgac
tttattgctatgctcaaacttacctatcaaccgttagtgctgatttttattattagtgca
tttttgtatgtgttaatcgagcaaggggtagggacttggttgcctacatttaataatcaa
gttttgcaattaccagtagctattagtattcaactagcgagtatttttgccgcagctctt
gctttagggcgtttagtggcgggccaagtattaaagcatattcattggtttgtagtactt
agctgttgtttagttgctatggctgcattgatcattattaccttaccactaacggaaaac
ttacctaaaagcgaggtgaatagtttatttgatgcgcctctggcggcgtttgttttgcca
ttaattggcttttttatggcacccatttatccggtactcaactcagtcatgctcagtgcg
cttcaaaagcatcaacatgctgcaatgacagggttaatcgttgtgttttcagcacttggt
ggcaccacagggtcggtgataaccgggtatgtatttgagcactttagtggccagcatgct
ttttatctttcacttgtgcccattagtttaatttttattagcgtgattatttttaaaaaa
cgcacccatgccatttcacaacacgcagtcaatagttaa

DBGET integrated database retrieval system