KEGG   Pseudoalteromonas sp. SM9913: PSM_B0243
Entry
PSM_B0243         CDS       T01374                                 

Definition
(GenBank) trehalase
  KO
K01194  alpha,alpha-trehalase [EC:3.2.1.28]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00500  Starch and sucrose metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_B0243
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:psm00537]
    PSM_B0243
Enzymes [BR:psm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.28  alpha,alpha-trehalase
     PSM_B0243
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:psm00537]
 Enzymes
  PSM_B0243
SSDB
Motif
Pfam: Trehalase Glyco_hydro_63
Other DBs
NCBI-ProteinID: ADT70283
Position
II:271401..272897
AA seq 498 aa
MSFFNSQLFKDVQTQHIFSDCKTFADATARVDWQSACKQYEQIAPLDKTQLRDFVDAHFI
TTPLLTMKGAANTTSVKGYINSLWSGLRREADTPKANSLLALKHSYIVPGGRFQEIYYWD
SYFTALGLIDADKSDVVEDMLQNFIDLINDYGCIPNGNRSYYLSRSQPPILALMVDLLWQ
HTHSKTHNLAWLKLCVEALTKEHAFWMQGADTLSDTQTSVKRVVTMPCGGVLNRYWDDEA
APRAESLREDLALASGFSDDKKTEFYRNIRAACESGWDFSSRWLAESNLLSSIQTTDIVP
IDLNCLLYNLENQLSECFKLLGNEQQSQTYSDYAVKRKSLINQYLWSNEQRFFVDYNHKL
SKPSAILSAAASTPLFVNLASQQQAELVANVLSEQFLKVGGIVTTVVDTPQQWDSPNGWA
PLQWFAVKGLRNYGIDQLATRIMKNWLTMVEQDFIENKCLLEKYNVCTPQQKASGGEYQV
QQGFGWTNGVTSRFYTLL
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgagtttttttaatagccaattatttaaagatgtacaaacacagcacatatttagcgac
tgtaaaacgtttgctgatgcaacagcgcgtgttgattggcaaagtgcctgtaaacagtat
gagcaaatagcaccccttgataaaactcaattaagagactttgttgatgcgcattttata
acaacacccttattaacaatgaaaggggctgcaaataccaccagtgtaaaaggctacata
aactcactgtggagcggccttcgacgtgaagccgatacacccaaagctaattctttactc
gctttaaagcacagctatattgtgcctggtggacgttttcaagaaatttattattgggat
agttactttactgcgctaggtttaattgatgcagataaaagtgatgtagtagaagacatg
ctacaaaactttatagacttaattaacgattacggctgcattccaaatggtaaccgcagt
tattatttatcgcgttcacaaccgcctattttagcgctgatggttgatcttttatggcag
cacactcacagtaaaacacataatttagcttggcttaaattgtgtgttgaagctttaaca
aaagagcacgcattttggatgcaaggagcagatacactcagtgatacgcaaacaagtgta
aaacgcgtggtaacaatgccatgtggtggggtattaaatcgctattgggatgatgaggcg
gctcctcgcgcagagtcattaagagaagacttagcgcttgcatcagggtttagtgatgat
aaaaaaactgagttttatcgtaatattcgtgctgcgtgcgaatctgggtgggactttagc
tcgcgctggttagccgagtcaaacttactaagctcaattcaaacgacagatattgtacct
atagatttaaattgcctactgtacaatttagaaaatcagcttagtgaatgctttaaattg
cttggcaatgagcaacaatcacaaacgtacagcgactatgctgtaaaaagaaagtcactt
attaatcaatatctttggagtaatgagcagcgtttttttgttgattataatcataagcta
tctaagccgtctgctattttaagtgcagcggcaagtaccccgctttttgttaatttagcc
tcgcaacagcaagctgaactggttgcaaacgtattgagcgagcagtttttaaaagtaggt
ggtattgtaacaacggttgttgatactccacagcaatgggacagcccgaatggctgggct
ccattacaatggtttgcggtaaaaggcttgcgtaattatggtattgatcaattagctaca
cgcataatgaaaaactggctaacaatggtagaacaagattttattgaaaataaatgcttg
ctcgaaaaatataacgtatgcacaccgcaacaaaaagccagcgggggtgaatatcaagta
caacaaggatttggttggactaacggtgttacatcacgcttttatacacttttatag

DBGET integrated database retrieval system