KEGG   Pseudoalteromonas sp. SM9913: PSM_B0244
Entry
PSM_B0244         CDS       T01374                                 

Definition
(GenBank) putative csg operon transcription regulator (LuxR family) protein
  KO
K20918  LuxR family transcriptional regulator, positive regulator of biofilm formation
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:psm03000]
    PSM_B0244
Transcription factors [BR:psm03000]
 Prokaryotic type
  Helix-turn-helix
   LuxR family
    PSM_B0244
SSDB
Motif
Pfam: GerE Sigma70_r4_2 HTH_23 HTH_38 Sigma70_r4 HTH_7 HTH_40 HTH_10 CENP-B_N HTH_24
Other DBs
NCBI-ProteinID: ADT70284
Position
II:273001..273690
AA seq 229 aa
MLQKSSAFIKTTLQSSFHSQNYTVILRTLQAIFGDIKMDSTIPHIDQRGAYDIFLIDGSQ
NDWQDLIPADLICLAKQYKVVLFNVELEQVCEKNLLLNHFNGVFYKSAAAEDIFKGLVRI
STGELWFTRKVISKAFNDILSVASSFSSLSEDITLNEADYKHLTKREKSVIHLIAQGASN
NKIADKLNISDHTVKTHLYSAFKKTNSRNRVELANWAQRYISVLLPVES
NT seq 690 nt   +upstreamnt  +downstreamnt
atgttgcaaaaaagctcggcttttattaagacaacgcttcaatcgtctttccattctcaa
aactacacagttattttaagaacacttcaagccatttttggtgatataaaaatggacagt
actatcccacatattgatcagcgtggtgcttatgacatttttctaattgatggctctcaa
aatgattggcaggacttgatcccagcagatttaatttgtttggctaaacagtataaagtt
gtgctttttaatgtagaactagagcaagtatgtgaaaaaaacttattactcaatcatttt
aatggggtattttataaatcggcagcagcagaagatatatttaaaggcttagtaagaatt
tctactggtgagctttggtttactcgtaaagtaatctctaaggcctttaatgatattcta
agtgtggcctcttcgtttagctccttaagcgaagatatcacgttaaatgaagctgactat
aagcatttaactaaacgagaaaaatcggttattcatttaatagcacaaggagcgagtaat
aataaaatagcggacaaactaaacattagcgaccacactgttaaaactcacctttatagc
gcatttaaaaaaactaattcgcgtaatagagttgaattggccaattgggcgcaaagatat
atttcagtattattacccgttgagagctaa

DBGET integrated database retrieval system