KEGG   Pseudoalteromonas sp. SM9913: PSM_B0245
Entry
PSM_B0245         CDS       T01374                                 

Gene name
csgG
Definition
(GenBank) putative assembly or transport protein for curli synthesis
  KO
K06214  curli production assembly/transport component CsgG
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0245 (csgG)
Secretion system [BR:psm02044]
 Extracellular nucleation-precipitation pathway
  Curli assembly protein
   PSM_B0245 (csgG)
SSDB
Motif
Pfam: CsgG CBP_BcsN PHF12_MRG_bd
Other DBs
NCBI-ProteinID: ADT70285
Position
II:complement(273743..274462)
AA seq 239 aa
MGNLIPPSKQSAVTLEPTDVFSDLKSLPKPAGSIPVSVYSFRDQTGQYKPQTNVSSFSTA
VTQGANSILVQALHESDWFTPVEREGLQNILTERKIIRAAQATNPNQGELPPLTTAKIIL
EGGIISYDTNVKTGGLGMEYFGIGASELYREDAISIYLRAVDVRTGQVLLSVATSKKVLS
QEMRAGFFRYVSYKRLAEAEAGFSDNEPMSICVTQAIEKALTDLITKGIDKGLWAKQAT
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggtaatttaatccctccgtcaaaacaaagtgcggtaacgttagagccaacagatgtc
ttttctgatttaaaaagcttacctaaacctgcgggcagcattccagtctcggtttattca
tttcgcgatcaaaccggtcaatataagccacaaactaatgttagctcgttttcaacggcc
gtcactcaaggtgcaaactctattctagtgcaagcattacatgagtctgactggtttacg
ccggttgaacgtgagggtctacaaaatattttaacagagagaaaaataattagagcggca
caagcgactaatcctaatcaaggcgagctaccgccgttaaccactgcgaaaatcatttta
gaaggcggtataattagttacgacaccaatgtaaaaacgggtggcttaggaatggaatat
tttggtattggcgcatcagagctatatcgtgaagatgcaatatcaatctatttacgtgcc
gtagatgtaagaactggccaggtattgttatcagtagccaccagcaaaaaagtattgagc
caagaaatgcgagcaggtttttttaggtatgttagctataaacgtctggcggaagctgag
gcgggctttagtgataatgaaccaatgagcatttgcgtaacgcaagcaatagaaaaggcg
cttacagatcttatcaccaaaggtattgataaaggcttatgggctaaacaggcaacttaa

DBGET integrated database retrieval system