KEGG   Pseudoalteromonas sp. SM9913: PSM_B0246
Entry
PSM_B0246         CDS       T01374                                 

Gene name
csgF
Definition
(GenBank) putative curli production assembly/transport component
  KO
K04338  curli production assembly/transport component CsgF
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0246 (csgF)
Secretion system [BR:psm02044]
 Extracellular nucleation-precipitation pathway
  Curli assembly protein
   PSM_B0246 (csgF)
SSDB
Motif
Pfam: CsgF Reo_P9 TAtT
Other DBs
NCBI-ProteinID: ADT70286
Position
II:complement(274516..274929)
AA seq 137 aa
MKKIALTIITTLSFSVSATEIIYTPINPSFGGNPLNANMLLSKAQAQNKHKAPVVEKGYA
EQFQDSLERTYLNRMVREITDMAFGENIEDSVFNQDSIFMSGDYQIEVITSTTDTITVRI
TNVIDDSVVVIEVPRFG
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaaaaaaatagcattaacaataataacaactttaagcttttcagtctccgcaactgaa
attatttatacccctattaacccgagttttggtggcaaccctctcaatgccaatatgctg
cttagtaaggcacaagcacaaaataaacataaagcgccggttgtcgaaaaagggtatgca
gagcagtttcaagattcattagagcggacatacttaaatcgaatggtgagagaaatcacc
gacatggcttttggggaaaatattgaagacagtgtttttaatcaagactccatttttatg
agtggtgattatcaaatagaagtgatcaccagtacaaccgacactatcacggttagaata
acaaatgtaattgatgactcggttgtggttatcgaagtaccgaggtttggataa

DBGET integrated database retrieval system