KEGG   Pseudoalteromonas sp. SM9913: PSM_B0247
Entry
PSM_B0247         CDS       T01374                                 

Definition
(GenBank) curli production assembly/transport component
  KO
K04337  curli production assembly/transport component CsgE
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psm02044]
    PSM_B0247
Secretion system [BR:psm02044]
 Extracellular nucleation-precipitation pathway
  Curli assembly protein
   PSM_B0247
SSDB
Motif
Pfam: CsgE Mad3_BUB1_I_2
Other DBs
NCBI-ProteinID: ADT70287
Position
II:complement(274932..275324)
AA seq 130 aa
MKNKQYIYLFILLTFFTPLSNASAELEIDGLLLNKSISRFGYQFYSEFSNYWRELPSTAG
FNVEIKETVIPRAGTKLVLIMNHKIIYATHLGRKLEPLDERVEQAVHSVMDAMARSNMQT
ASPDMALNGW
NT seq 393 nt   +upstreamnt  +downstreamnt
atgaaaaataaacaatatatctatctttttatacttttaactttttttactcctttgagt
aatgccagtgctgaattagaaatcgatggattattactaaacaaaagtattagtcgcttt
gggtatcaattttacagtgaattttcaaattattggcgtgaactaccttcaacagctggc
tttaatgtagaaataaaagaaacggttataccccgtgctggtactaaattagttttaata
atgaatcataagattatttatgcaacccatttgggacgaaagttagagcctttggacgag
cgagtagagcaagcagtgcactctgtaatggacgccatggcgcgatcgaatatgcaaaca
gcgagtcctgatatggcattgaatggatggtaa

DBGET integrated database retrieval system