KEGG   Pseudoalteromonas sp. SM9913: PSM_B0248
Entry
PSM_B0248         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70288
Position
II:276841..276966
AA seq 41 aa
MHSLKVIYSISLLFSLKDKIKYLDYLLSFKKVFSLQHAVLP
NT seq 126 nt   +upstreamnt  +downstreamnt
ttgcacagcttaaaagtgatttattcaatttcattattattctccttgaaagataaaata
aaataccttgattatttattaagttttaaaaaggtattttcgttgcagcatgccgtgctg
ccataa

DBGET integrated database retrieval system